DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32944 and DBF20

DIOPT Version :9

Sequence 1:NP_788574.3 Gene:CG32944 / 40560 FlyBaseID:FBgn0052944 Length:576 Species:Drosophila melanogaster
Sequence 2:NP_015436.1 Gene:DBF20 / 856227 SGDID:S000006315 Length:564 Species:Saccharomyces cerevisiae


Alignment Length:393 Identity:98/393 - (24%)
Similarity:162/393 - (41%) Gaps:95/393 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   151 FQILRAIGKGSFGKVCIVQKRDTGILYAMKYVSRSACEMRGALGGVIKEVELLSSLEHPFLVNLW 215
            ||||..:|:|.:|:|.:.:|:|:..:.|:|.:::...........|:.|.::|::....:||.|.
Yeast   169 FQILTQVGQGGYGQVYLAKKKDSDEICALKILNKKLLFKLNETNHVLTERDILTTTRSDWLVKLL 233

  Fly   216 FSFQDEEDLFMVCDLLTGGDLRYHLQNRVEFSEQSVALLVCELGSALEYLQANRVVHRDIKPDNI 280
            ::|||.|.|::..:.:.|||.|..|.|............:.|:..|:..|......|||:||:|.
Yeast   234 YAFQDPESLYLAMEFVPGGDFRTLLINTRILKSGHARFYISEMFCAVNALHELGYTHRDLKPENF 298

  Fly   281 LLDDAGHAHLTDFNIAT-------------RLQ--KNA--------------------------L 304
            |:|..||..||||.:|.             ||:  ||.                          .
Yeast   299 LIDATGHIKLTDFGLAAGTVSNERIESMKIRLEEVKNLEFPAFTERSIEDRRKIYHNMRKTEINY 363

  Fly   305 ACSMSGTKPYMAPEVFLCALDEVAGYSYPVDWWSLGVVAYEMRGNIRPFVVHSNTPLAEIKNILN 369
            |.||.|:..|||.||.     |...|.:.||:||||.:.:|......||...|.....|  |:  
Yeast   364 ANSMVGSPDYMALEVL-----EGKKYDFTVDYWSLGCMLFESLVGYTPFSGSSTNETYE--NL-- 419

  Fly   370 TPVHYPRYW----------------SSNFVDLLQRLLSTYPGARISTRQELHQTPMLRNIDFQRV 418
                  |||                |....||:.||::. |..|:.:.:::.:......|:|:.:
Yeast   420 ------RYWKKTLRRPRTEDRRAAFSDRTWDLITRLIAD-PINRVRSFEQVRKMSYFAEINFETL 477

  Fly   419 LEKKIKPIYKPP----------EDHLNCDPCLELEEMIVESRPLHKKKKRLAKQRSAQRDSDPET 473
              :...|.:.|.          :|..|       ||.:.:...:.|::.:|:   :...||..::
Yeast   478 --RTSSPPFIPQLDDETDAGYFDDFTN-------EEDMAKYADVFKRQNKLS---AMVDDSAVDS 530

  Fly   474 ALV 476
            .||
Yeast   531 KLV 533

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32944NP_788574.3 STKc_Yank1 150..410 CDD:270730 84/315 (27%)
S_TKc 151..405 CDD:214567 84/310 (27%)
DBF20NP_015436.1 STKc_Sid2p_like 157..539 CDD:270751 98/393 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157344974
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.