DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32944 and AT4G13000

DIOPT Version :9

Sequence 1:NP_788574.3 Gene:CG32944 / 40560 FlyBaseID:FBgn0052944 Length:576 Species:Drosophila melanogaster
Sequence 2:NP_193036.1 Gene:AT4G13000 / 826913 AraportID:AT4G13000 Length:372 Species:Arabidopsis thaliana


Alignment Length:363 Identity:100/363 - (27%)
Similarity:157/363 - (43%) Gaps:73/363 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   141 QSLIP-INFDHFQILRAIGKGSFGKVCIVQKRDTGILYAMKYVSRSACEMRGA---LGGVIKEVE 201
            ::.|| :||||.:|..|:|:||.|.|.:| |.|...| |:|.:.|.:.|.:.|   ...:..|..
plant     9 ENKIPTLNFDHLEIFSALGRGSKGVVFLV-KADNKWL-ALKVILRESIESKKAKDEYKRISFEQG 71

  Fly   202 LLSSLEHPFLVNLWFSFQDEEDLFMVCDLLTGGDLRYHLQNRVE--FSEQSVALLVCELGSALEY 264
            :||..:||....|......::.:....|...|.||....:.:.|  ||::.:.....||..||||
plant    72 VLSRFDHPLFPRLHGVISTDKVIGYAIDYCPGRDLNSLRKKQSEEMFSDEIIRFYAAELVIALEY 136

  Fly   265 LQANRVVHRDIKPDNILLDDAGHAHLTDFNIATRLQKNALACSMS-------------------- 309
            |....:|:||:||||:::.:.||..|.||:::|.|.......|.|                    
plant   137 LHNQGIVYRDLKPDNVMIQENGHLMLVDFDLSTNLPPRTPQSSFSSSPRLSTATKKERSIFAFSG 201

  Fly   310 -----------------------------GTKPYMAPEVFLCALDEVAGYSYPVDWWSLGVVAYE 345
                                         ||:.|:||||.     ..:|:.:.|||||||||.||
plant   202 LCNSGISPDDSVSRSSESEFSGEKSNSFVGTEEYVAPEVI-----TGSGHDFAVDWWSLGVVLYE 261

  Fly   346 MRGNIRPFVVHSNTPLAEIKNILNTPVHYPRYWSSNFVDLLQRLLSTYPGARISTRQELHQTPML 410
            |.....|| ..||.....:|.:...|.....  :::..||:::||...|..||:. :.:......
plant   262 MLYGATPF-RGSNRKETFLKILTEPPSLVGE--TTSLRDLVRKLLEKDPSRRINV-EGIKGHDFF 322

  Fly   411 RNIDFQRVLEKKIKPIYKPPEDHLNCDPCLELEEMIVE 448
            :.:|:..||:....|....||::       |:.::.||
plant   323 KGLDWDLVLKVSRPPYIPAPENY-------EISKIDVE 353

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32944NP_788574.3 STKc_Yank1 150..410 CDD:270730 86/313 (27%)
S_TKc 151..405 CDD:214567 85/307 (28%)
AT4G13000NP_193036.1 PKc_like 18..342 CDD:419665 91/334 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.