DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32944 and si:ch211-195b13.1

DIOPT Version :9

Sequence 1:NP_788574.3 Gene:CG32944 / 40560 FlyBaseID:FBgn0052944 Length:576 Species:Drosophila melanogaster
Sequence 2:NP_001070770.2 Gene:si:ch211-195b13.1 / 768159 ZFINID:ZDB-GENE-030131-7626 Length:423 Species:Danio rerio


Alignment Length:312 Identity:106/312 - (33%)
Similarity:156/312 - (50%) Gaps:37/312 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   145 PINFDHFQILRAIGKGSFGKVCIVQKRDTGILYAMKYVSRSACEMRGALGGVIKEVE-------- 201
            |.:||:   |:.|||||||||.:.:.::..:.||:|.:.:..         ::|:.|        
Zfish    88 PSDFDY---LKIIGKGSFGKVLLARHKENELYYAVKVLQKKI---------IMKKKEQKHIMAER 140

  Fly   202 --LLSSLEHPFLVNLWFSFQDEEDLFMVCDLLTGGDLRYHLQNRVEFSEQSVALLVCELGSALEY 264
              |:.:::|||||.|.:|||..:.|:.|.|.:.||:|.||||....|.|........|:.|||.|
Zfish   141 SVLMKNIKHPFLVGLHYSFQTTDKLYFVLDYVNGGELFYHLQRERVFLEPRARFYAAEIASALGY 205

  Fly   265 LQANRVVHRDIKPDNILLDDAGHAHLTDFNIATR-LQKNALACSMSGTKPYMAPEVFLCALDEVA 328
            |.:..:|:||:||:|||||..||..||||.:... |..|....:..||..|:||||.     :..
Zfish   206 LHSLHIVYRDLKPENILLDSQGHIVLTDFGLCKEGLDPNGTTTTFCGTPEYLAPEVL-----QKQ 265

  Fly   329 GYSYPVDWWSLGVVAYEMRGNIRPFVVHSNTPLAEIKNILNTPVHYPRYWSSNFVDLLQRLLSTY 393
            .|...||||.||.|.:||...:.||  :|........|||:.|:......|:...|||:.||...
Zfish   266 AYDRTVDWWCLGSVLFEMLYGLPPF--YSRNTAEMYNNILHKPLVLKPNVSNAGRDLLEGLLHKD 328

  Fly   394 PGARISTRQ---ELHQTPMLRNIDFQRVLEKKIKPIYKP----PEDHLNCDP 438
            ...|:.::.   ||........|::..::.|:|.|.:.|    |.|..:.||
Zfish   329 RTKRLGSKDDFLELKFHSFFSPINWDDLMAKRIVPPFIPTVTGPTDLRHFDP 380

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32944NP_788574.3 STKc_Yank1 150..410 CDD:270730 94/273 (34%)
S_TKc 151..405 CDD:214567 93/267 (35%)
si:ch211-195b13.1NP_001070770.2 S_TKc 91..348 CDD:214567 96/275 (35%)
STKc_SGK 95..415 CDD:270727 102/302 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170589152
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0598
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.830

Return to query results.
Submit another query.