DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32944 and sgk2a

DIOPT Version :9

Sequence 1:NP_788574.3 Gene:CG32944 / 40560 FlyBaseID:FBgn0052944 Length:576 Species:Drosophila melanogaster
Sequence 2:NP_001107094.1 Gene:sgk2a / 570956 ZFINID:ZDB-GENE-030131-9632 Length:361 Species:Danio rerio


Alignment Length:312 Identity:108/312 - (34%)
Similarity:152/312 - (48%) Gaps:37/312 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   145 PINFDHFQILRAIGKGSFGKVCIVQKRDTGILYAMKYVSRSACEMRGALGGVIKEVE-------- 201
            |.:||   .|..||||:||||.:.:.:..|..||:|.:.:..         ::|:.|        
Zfish    27 PTDFD---FLAVIGKGTFGKVLLAKLKADGKFYAVKVLQKKV---------ILKKKEQKNIMAER 79

  Fly   202 --LLSSLEHPFLVNLWFSFQDEEDLFMVCDLLTGGDLRYHLQNRVEFSEQSVALLVCELGSALEY 264
              ||.||:|||||.|.:|||..|.|:.|.|.:.||:|.||||....|||........|:.||:.|
Zfish    80 NVLLKSLKHPFLVGLHYSFQTSEKLYFVLDYVNGGELFYHLQRERCFSEPRARFYTAEVASAIGY 144

  Fly   265 LQANRVVHRDIKPDNILLDDAGHAHLTDFNIATR-LQKNALACSMSGTKPYMAPEVFLCALDEVA 328
            |.:..:|:||:||:|||||..||..||||.:... ::......:..||..|:||||.     ...
Zfish   145 LHSLNIVYRDLKPENILLDYQGHVVLTDFGLCKEGIEPEGTTTTFCGTPEYLAPEVL-----RKE 204

  Fly   329 GYSYPVDWWSLGVVAYEMRGNIRPFVVHSNTPLAEIKNILNTPVHYPRYWSSNFVDLLQRLLSTY 393
            .|...||||.||.|.:||..::.||.....:.:.:.  ||:.|:|.|...|.:...||..||...
Zfish   205 PYDRTVDWWCLGAVLHEMLYSLPPFYSRDVSEMYDA--ILHKPLHLPPGKSESACLLLYGLLQKD 267

  Fly   394 PGAR---ISTRQELHQTPMLRNIDFQRVLEKKIKPIYKP----PEDHLNCDP 438
            ...|   |:...|:........|::..:..|:|.|.|.|    |.|..:.||
Zfish   268 QHRRTGAIADFLEIKNHVFFAPINWDDLYHKRITPPYNPNVRGPADLQHIDP 319

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32944NP_788574.3 STKc_Yank1 150..410 CDD:270730 95/273 (35%)
S_TKc 151..405 CDD:214567 95/267 (36%)
sgk2aNP_001107094.1 S_TKc 30..287 CDD:214567 97/275 (35%)
STKc_SGK2 34..355 CDD:270754 104/302 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0598
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.