DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32944 and gwl

DIOPT Version :9

Sequence 1:NP_788574.3 Gene:CG32944 / 40560 FlyBaseID:FBgn0052944 Length:576 Species:Drosophila melanogaster
Sequence 2:NP_524860.2 Gene:gwl / 45969 FlyBaseID:FBgn0260399 Length:846 Species:Drosophila melanogaster


Alignment Length:196 Identity:65/196 - (33%)
Similarity:104/196 - (53%) Gaps:20/196 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   110 PRQRLQLI---QIIPKFH-----PEDHSLAMGHMLCVKCQSLIPINFDHFQILRAIGKGSFGKVC 166
            |::...||   |::.|.:     ||:||.          .:.:|...| |.|::.|.:|:||||.
  Fly    19 PKKTHSLIDSEQLLDKINILTTKPENHSQ----------NAKLPTIKD-FVIIKPISRGAFGKVF 72

  Fly   167 IVQK-RDTGILYAMKYVSRSACEMRGALGGVIKEVELLSSLEHPFLVNLWFSFQDEEDLFMVCDL 230
            :..| .|:..|:|:|.:.:|....:..:..||.|...|:.....|.|:|::|.|....:::|.:.
  Fly    73 LGYKNNDSKRLFAIKVMRKSEMINKNMVSQVITERNALALSRSQFCVSLFYSLQSLSYVYLVMEY 137

  Fly   231 LTGGDLRYHLQNRVEFSEQSVALLVCELGSALEYLQANRVVHRDIKPDNILLDDAGHAHLTDFNI 295
            :.||||:..|.....|.|.:....|.|:..||:||..:.:|||||||||:||..:||..||||.:
  Fly   138 MVGGDLKSLLAMFGYFDEPTARFYVAEMVMALQYLHQHGIVHRDIKPDNMLLSSSGHVKLTDFGL 202

  Fly   296 A 296
            :
  Fly   203 S 203

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32944NP_788574.3 STKc_Yank1 150..410 CDD:270730 54/148 (36%)
S_TKc 151..405 CDD:214567 54/147 (37%)
gwlNP_524860.2 STKc_MASTL 52..>255 CDD:270761 56/153 (37%)
S_TKc 57..>205 CDD:214567 54/147 (37%)
PKc_like <655..835 CDD:304357
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45458922
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24356
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.