DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32944 and Pkn

DIOPT Version :9

Sequence 1:NP_788574.3 Gene:CG32944 / 40560 FlyBaseID:FBgn0052944 Length:576 Species:Drosophila melanogaster
Sequence 2:NP_001097237.1 Gene:Pkn / 35950 FlyBaseID:FBgn0020621 Length:1501 Species:Drosophila melanogaster


Alignment Length:351 Identity:105/351 - (29%)
Similarity:177/351 - (50%) Gaps:42/351 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   146 INFDHFQILRAIGKGSFGKVCIVQKRDTGILYAMKYVSRSACEMRGALGGVIKE---VELLSSLE 207
            ::.|:|::|..:|:|.||||.:.|.|.....||:|.:.:.....|..:..::.|   .|:.:::.
  Fly  1169 LSMDNFRLLSVLGRGHFGKVILSQLRSNNQYYAIKALKKGDIIARDEVESLLSEKRIFEVANAMR 1233

  Fly   208 HPFLVNLWFSFQDEEDLFMVCDLLTGGDLRYHLQNRVEFSEQSVALLVC-ELGSALEYLQANRVV 271
            |||||||:..||.|:.:..|.:...||||..|:...|....::|....| .||  |:||..|:::
  Fly  1234 HPFLVNLYSCFQTEQHVCFVMEYAAGGDLMMHIHTDVFLEPRAVFYAACVVLG--LQYLHENKII 1296

  Fly   272 HRDIKPDNILLDDAGHAHLTDFNIATRLQKNALAC-----SMSGTKPYMAPEVFLCALDEVAGYS 331
            :||:|.||:|||..|:..:.||.:.    |..:..     :..||..::||||    |.|.: |:
  Fly  1297 YRDLKLDNLLLDTEGYVKIADFGLC----KEGMGFGDRTGTFCGTPEFLAPEV----LTETS-YT 1352

  Fly   332 YPVDWWSLGVVAYEMRGNIRPFVVHSNTPLAEIKNILNTPVHYPRYWSSNFVDLLQRLLSTYPGA 396
            ..||||.|||:.:||.....||.......:.:  :|:|..|.|||:.|...:.:::|||...|..
  Fly  1353 RAVDWWGLGVLIFEMLVGESPFPGDDEEEVFD--SIVNDEVRYPRFLSLEAIAVMRRLLRKNPER 1415

  Fly   397 RIST----RQELHQTPMLRNIDFQRVLEKKIKPIYKPPEDHL----NCDPCLELEEMIVESRPLH 453
            |:.:    .:::.:....|:|.:..:|.:|:||.:.|..:||    |.|     ||...|     
  Fly  1416 RLGSSERDAEDVKKQAFFRSIVWDDLLLRKVKPPFVPTINHLEDVSNFD-----EEFTSE----- 1470

  Fly   454 KKKKRLAKQRSAQRDSDPETALVKEF 479
              |.:|...:..:..::.|..|.::|
  Fly  1471 --KAQLTPPKEPRHLTEEEQLLFQDF 1494

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32944NP_788574.3 STKc_Yank1 150..410 CDD:270730 85/272 (31%)
S_TKc 151..405 CDD:214567 85/266 (32%)
PknNP_001097237.1 HR1_PKN_1 131..194 CDD:212012
HR1_PKN_2 243..309 CDD:212013
HR1_PKN_3 340..414 CDD:212015
C2 530..611 CDD:301316
STKc_PKN 1174..1499 CDD:270741 104/346 (30%)
S_TKc 1174..1433 CDD:214567 85/271 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24356
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.