DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32944 and sgk1

DIOPT Version :9

Sequence 1:NP_788574.3 Gene:CG32944 / 40560 FlyBaseID:FBgn0052944 Length:576 Species:Drosophila melanogaster
Sequence 2:XP_005162356.1 Gene:sgk1 / 324140 ZFINID:ZDB-GENE-030131-2860 Length:598 Species:Danio rerio


Alignment Length:315 Identity:108/315 - (34%)
Similarity:153/315 - (48%) Gaps:43/315 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   145 PINFDHFQILRAIGKGSFGKVCIVQKRDTGILYAMKYVSRSACEMRGALGGVIKEVE-------- 201
            |.:||   .|:.|||||||||.:.:.|.....||:|.:.:.|         ::|:.|        
Zfish   262 PSDFD---FLKVIGKGSFGKVLLARHRSDEKFYAVKVLQKKA---------ILKKKEEKHIMSER 314

  Fly   202 --LLSSLEHPFLVNLWFSFQDEEDLFMVCDLLTGGDLRYHLQNRVEFSEQSVALLVCELGSALEY 264
              ||.:::|||||.|.:|||..:.|:.|.|.:.||:|.||||....|.|........|:.|||.|
Zfish   315 NVLLKNVKHPFLVGLHYSFQTTDKLYFVLDYINGGELFYHLQRERCFLEPRARFYAAEIASALGY 379

  Fly   265 LQANRVVHRDIKPDNILLDDAGHAHLTDFNIA-TRLQKNALACSMSGTKPYMAPEVFLCALDEVA 328
            |.:..:|:||:||:|||||..||..||||.:. ..::.|....:..||..|:||||.     ...
Zfish   380 LHSLNIVYRDLKPENILLDSQGHIILTDFGLCKENIEPNGTTSTFCGTPEYLAPEVL-----HKQ 439

  Fly   329 GYSYPVDWWSLGVVAYEMRGNIRPFVVHSNTPLAEIKNILNTPVHYPRYWSSNFVDLLQRLLSTY 393
            .|...||||.||.|.|||...:.||  :|........||||.|:......|:....||:.||...
Zfish   440 PYDRTVDWWCLGAVLYEMLYGLPPF--YSRNTAEMYDNILNKPLQLKPNISNAARHLLEGLLQKD 502

  Fly   394 PGARISTRQELHQTPMLRN------IDFQRVLEKKIKPIYKP----PEDHLNCDP 438
            ...|:....:..:   ::|      |::..:..||:.|.:.|    |.|..:.||
Zfish   503 RTKRLGFTDDFTE---IKNHMFFSPINWDDLNAKKLTPPFNPNVTGPNDLRHFDP 554

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32944NP_788574.3 STKc_Yank1 150..410 CDD:270730 95/270 (35%)
S_TKc 151..405 CDD:214567 95/264 (36%)
sgk1XP_005162356.1 STKc_SGK1 257..595 CDD:270753 108/315 (34%)
S_TKc 265..522 CDD:214567 98/278 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170589151
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0598
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.