DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32944 and Pkcdelta

DIOPT Version :9

Sequence 1:NP_788574.3 Gene:CG32944 / 40560 FlyBaseID:FBgn0052944 Length:576 Species:Drosophila melanogaster
Sequence 2:NP_572797.3 Gene:Pkcdelta / 32191 FlyBaseID:FBgn0259680 Length:1894 Species:Drosophila melanogaster


Alignment Length:323 Identity:102/323 - (31%)
Similarity:161/323 - (49%) Gaps:37/323 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   119 IIPKFHPEDHSLAMGHMLCVKCQSLIPINFDHFQILRAIGKGSFGKVCIVQKRDTGILYAMKYVS 183
            :||:|  :::|:                  |.|..|..:||||||||.:.:.|||...||:|.:.
  Fly  1554 VIPRF--KNYSV------------------DDFHFLAVLGKGSFGKVLLAELRDTTYYYAIKCLK 1598

  Fly   184 RSACEMRGALGGVIKEVELLS-SLEHPFLVNLWFSFQDEEDLFMVCDLLTGGDLRYHLQNRVEFS 247
            :........:...:.|.::|: ..:||:|.:|:.:||.|..||.|.:.|.||||.:|:|....||
  Fly  1599 KDVVLEDDDVDSTLIERKVLALGTKHPYLCHLFCTFQTESHLFFVMEYLNGGDLMFHIQESGRFS 1663

  Fly   248 EQSVALLVCELGSALEYLQANRVVHRDIKPDNILLDDAGHAHLTDFNIA-TRLQKNALACSMSGT 311
            |:.......|:.|.|::|....:::||:|.||:|||..||..:.||.:. .::..:..|.|..||
  Fly  1664 EERARFYGAEIISGLKFLHKKGIIYRDLKLDNVLLDYEGHVRIADFGMCKLQIYLDKTADSFCGT 1728

  Fly   312 KPYMAPEVFLCALDEVAG--YSYPVDWWSLGVVAYEMRGNIRPFVVHSNTPLAEIKNILNTPVHY 374
            ..|||||:       :.|  |:..|||||.||:.|||.....||.......|  ..:|.|....:
  Fly  1729 PDYMAPEI-------IKGEKYNQNVDWWSFGVLLYEMLIGQSPFSGCDEDEL--FWSICNEIPWF 1784

  Fly   375 PRYWSSNFVDLLQRLL-STYP---GARISTRQELHQTPMLRNIDFQRVLEKKIKPIYKPPEDH 433
            |.|.|:....:|:.|| ..|.   |::.|...::......|.||:..:.:::|:|.:||...|
  Fly  1785 PVYISAEATGILKGLLEKDYTKRIGSQYSPAGDIADHIFFRPIDWGLLEKRQIEPPFKPQVKH 1847

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32944NP_788574.3 STKc_Yank1 150..410 CDD:270730 89/267 (33%)
S_TKc 151..405 CDD:214567 89/261 (34%)
PkcdeltaNP_572797.3 S_TKc 1566..1824 CDD:214567 89/266 (33%)
STKc_nPKC_theta_like 1570..1889 CDD:270744 95/287 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24356
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.