DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32944 and Sgk3

DIOPT Version :9

Sequence 1:NP_788574.3 Gene:CG32944 / 40560 FlyBaseID:FBgn0052944 Length:576 Species:Drosophila melanogaster
Sequence 2:NP_001362972.1 Gene:Sgk3 / 171498 RGDID:620242 Length:496 Species:Rattus norvegicus


Alignment Length:449 Identity:136/449 - (30%)
Similarity:202/449 - (44%) Gaps:89/449 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 LEIP---LLGDDF--RFLLASACQQLHELRISFLGREHFQALIMHCFPNLW-------LLQVDVL 103
            |:||   :.||:|  .|:         :.|.:.| .|..|.|:.  :|.|:       .||:|  
  Rat    70 LKIPAKRIFGDNFDPDFI---------KQRRAGL-NEFIQNLVR--YPELYNHPDVRAFLQMD-- 120

  Fly   104 PPFFLCPRQRLQLIQ-----IIPKFHPEDHSLAMGHMLCVKCQSLIPINFDH-----FQILRAIG 158
                 .||.:....:     ..||.|....::.:|           |....|     |..|:.||
  Rat   121 -----SPRHQSDPSEDEDERSTPKPHSTSRNINLG-----------PTGNPHAKPSDFDFLKVIG 169

  Fly   159 KGSFGKVCIVQKRDTGILYAMKYVSRSACEMRGALGGVIKEVE-LLSSLEHPFLVNLWFSFQDEE 222
            |||||||.:.:::..|..||:|.:.:.....|.....::.|.. ||.:::|||||.|.:|||..|
  Rat   170 KGSFGKVLLAKRKLDGKFYAVKVLQKKIVLNRKEQKHIMAERNVLLKNVKHPFLVGLHYSFQTTE 234

  Fly   223 DLFMVCDLLTGGDLRYHLQNRVEFSEQSVALLVCELGSALEYLQANRVVHRDIKPDNILLDDAGH 287
            .|:.|.|.:.||:|.:|||....|.|........|:.|||.||.:.::|:||:||:|||||..||
  Rat   235 KLYFVLDFVNGGELFFHLQRERSFPEPRARFYAAEIASALGYLHSIKIVYRDLKPENILLDSMGH 299

  Fly   288 AHLTDFNIATRLQKNALACS-----MSGTKPYMAPEVFLCALDEVAGYSYPVDWWSLGVVAYEMR 347
            ..||||.:.    |..:|.|     ..||..|:||||.     ....|...||||.||.|.|||.
  Rat   300 VVLTDFGLC----KEGIAISDTTTTFCGTPEYLAPEVI-----RKQPYDNTVDWWCLGAVLYEML 355

  Fly   348 GNIRPFVVHSNTPLAEI-KNILNTPVHYPRYWSSNFVDLLQRLLSTYPGARISTRQ---ELHQTP 408
            ..:.||....   :||: .|||:.|::.....|.....:|:.||......|:..::   |:...|
  Rat   356 YGLPPFYCRD---VAEMYDNILHKPLNLRPGVSLTAWSILEELLEKNRQNRLGAKEDFLEIQNHP 417

  Fly   409 MLRNIDFQRVLEKKIKPIYKP----PEDHLNCDP-----------CLELEEMIVESRPL 452
            ...::.:..:::|||.|.:.|    |:|..|.|.           |:..:..||.:..|
  Rat   418 FFESLSWTDLVQKKIPPPFNPNVAGPDDIRNFDAVFTEETVPYSVCVSSDYSIVNASVL 476

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32944NP_788574.3 STKc_Yank1 150..410 CDD:270730 99/274 (36%)
S_TKc 151..405 CDD:214567 97/263 (37%)
Sgk3NP_001362972.1 PX_CISK 12..120 CDD:132780 16/61 (26%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 121..157 7/46 (15%)
STKc_SGK3 165..490 CDD:270755 110/324 (34%)
Nuclear localization signal. /evidence=ECO:0000250 195..205 1/9 (11%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.