DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32944 and C8orf44-SGK3

DIOPT Version :9

Sequence 1:NP_788574.3 Gene:CG32944 / 40560 FlyBaseID:FBgn0052944 Length:576 Species:Drosophila melanogaster
Sequence 2:NP_001191102.1 Gene:C8orf44-SGK3 / 100533105 HGNCID:48354 Length:496 Species:Homo sapiens


Alignment Length:361 Identity:116/361 - (32%)
Similarity:169/361 - (46%) Gaps:53/361 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   122 KFHPEDHSLAMGHMLCVKCQSLIPINFDH-----FQILRAIGKGSFGKVCIVQKRDTGILYAMKY 181
            |.|....::.:|           |....|     |..|:.|||||||||.:.:::..|..||:|.
Human   139 KLHSTSQNINLG-----------PSGNPHAKPTDFDFLKVIGKGSFGKVLLAKRKLDGKFYAVKV 192

  Fly   182 VSRSACEMRGALGGVIKEVE-LLSSLEHPFLVNLWFSFQDEEDLFMVCDLLTGGDLRYHLQNRVE 245
            :.:.....|.....::.|.. ||.:::|||||.|.:|||..|.|:.|.|.:.||:|.:|||....
Human   193 LQKKIVLNRKEQKHIMAERNVLLKNVKHPFLVGLHYSFQTTEKLYFVLDFVNGGELFFHLQRERS 257

  Fly   246 FSEQSVALLVCELGSALEYLQANRVVHRDIKPDNILLDDAGHAHLTDFNIATRLQKNALACS--- 307
            |.|........|:.|||.||.:.::|:||:||:|||||..||..||||.:.    |..:|.|   
Human   258 FPEHRARFYAAEIASALGYLHSIKIVYRDLKPENILLDSVGHVVLTDFGLC----KEGIAISDTT 318

  Fly   308 --MSGTKPYMAPEVFLCALDEVAGYSYPVDWWSLGVVAYEMRGNIRPFVVHSNTPLAEI-KNILN 369
              ..||..|:||||.     ....|...||||.||.|.|||...:.||....   :||: .|||:
Human   319 TTFCGTPEYLAPEVI-----RKQPYDNTVDWWCLGAVLYEMLYGLPPFYCRD---VAEMYDNILH 375

  Fly   370 TPVHYPRYWSSNFVDLLQRLLSTYPGARISTRQ---ELHQTPMLRNIDFQRVLEKKIKPIYKP-- 429
            .|:......|.....:|:.||......|:..::   |:...|...::.:..:::|||.|.:.|  
Human   376 KPLSLRPGVSLTAWSILEELLEKDRQNRLGAKEDFLEIQNHPFFESLSWADLVQKKIPPPFNPNV 440

  Fly   430 --PEDHLNCDP-----------CLELEEMIVESRPL 452
              |:|..|.|.           |:..:..||.:..|
Human   441 AGPDDIRNFDTAFTEETVPYSVCVSSDYSIVNASVL 476

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32944NP_788574.3 STKc_Yank1 150..410 CDD:270730 99/274 (36%)
S_TKc 151..405 CDD:214567 97/263 (37%)
C8orf44-SGK3NP_001191102.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..21
PX_CISK 12..120 CDD:132780
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 121..156 4/27 (15%)
STKc_SGK3 165..490 CDD:270755 110/324 (34%)
Nuclear localization signal. /evidence=ECO:0000250 195..205 1/9 (11%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0598
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.