DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lost and COG0212

DIOPT Version :9

Sequence 1:NP_649466.1 Gene:lost / 40559 FlyBaseID:FBgn0263594 Length:545 Species:Drosophila melanogaster
Sequence 2:NP_565139.1 Gene:COG0212 / 844007 AraportID:AT1G76730 Length:354 Species:Arabidopsis thaliana


Alignment Length:275 Identity:96/275 - (34%)
Similarity:150/275 - (54%) Gaps:9/275 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 AVAAENGGNTAQEVSSTTQPIEPT--KRSLRVQTWKKIQEGKVGIGFNNIFNRIPSFVGADKAAA 72
            |.|.|:...||::...:....:|.  |..:|.:.|..::.....:....:.:|||:||||..||.
plant    66 AAAMEDMAETAKKELESDPDSDPKAWKWVIRKKMWDLMEARNYAMSPRPVHHRIPNFVGASAAAR 130

  Fly    73 LFANEEEFKKAQHIKVNIDRVLHEFKELALLADKSVYLPSTRESSAL--CLKVDVLADATEEQKK 135
            ..|..:.|:.|..:|||.|....:.:.|.|..:|.:..|..|..:..  .|:.|:|   ..|...
plant   131 KLAELDAFRMAMVVKVNPDSPQKQIRFLTLSGEKKLLTPQPRLRTGFFSVLESDLL---KPETIM 192

  Fly   136 EALRVQDIQKFRSEIGLDSGLKLDIVVIGSVVVS-REGYRIGRGNGFADLDIGLLIELGAITPKT 199
            ||.....:.|:...||||..:|:|::|||||.|: :.|.|:|:|.|||:|:.|:|..:|||...|
plant   193 EACTSVGVAKYGRAIGLDEKIKVDLIVIGSVAVNPQTGARLGKGEGFAELEYGMLRYMGAIDDST 257

  Fly   200 IIVTIVHDMQVVDSLPPNLFQKYDTPVDIIATPTEIIRVPKRLSFPNGVYWELLSERRLKILPVL 264
            .:||.|||.|:||.:|......:|.|||||.|||.:|.....:..|.|:||:.||..:|:.:.:|
plant   258 PVVTTVHDCQLVDDIPLEKLAIHDVPVDIICTPTRVIFTNTPIPKPQGIYWDKLSPEKLRQIRIL 322

  Fly   265 QQLKER-EEKAGKSI 278
            ::||.| |:|.|:.:
plant   323 RELKNRLEKKTGRKL 337

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lostNP_649466.1 5-FTHF_cyc-lig 67..238 CDD:294257 67/173 (39%)
RRM_MTHFSD 384..455 CDD:240716
COG0212NP_565139.1 5-FTHF_cyc-lig 92..290 CDD:396398 72/200 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 121 1.000 Domainoid score I1872
eggNOG 1 0.900 - - E1_COG0212
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H11245
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1137978at2759
OrthoFinder 1 1.000 - - FOG0006138
OrthoInspector 1 1.000 - - oto3741
orthoMCL 1 0.900 - - OOG6_105117
Panther 1 1.100 - - LDO PTHR13017
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X4426
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1211.780

Return to query results.
Submit another query.