Sequence 1: | NP_649466.1 | Gene: | lost / 40559 | FlyBaseID: | FBgn0263594 | Length: | 545 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_081105.1 | Gene: | Mthfs / 107885 | MGIID: | 1340032 | Length: | 203 | Species: | Mus musculus |
Alignment Length: | 224 | Identity: | 46/224 - (20%) |
---|---|---|---|
Similarity: | 80/224 - (35%) | Gaps: | 72/224 - (32%) |
- Green bases have known domain annotations that are detailed below.
Fly 30 IEPTKRSLRVQTWKKIQ--------------EGKVGIGFNNIFN--RIPSFVG-ADKAAALFANE 77
Fly 78 EEFKKA--------QHIKVNIDRV-LHEFKELALLADKS--VYLPSTRESSALCLKVDVLADATE 131
Fly 132 EQKKEALRVQDIQKFRSEIGLDSGLKLDIVVIGSVVVSREGYRIGRGNGFADLDIGLLIELGAIT 196
Fly 197 PKTIIVTI-----------VHDMQVVDSL 214 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
lost | NP_649466.1 | 5-FTHF_cyc-lig | 67..238 | CDD:294257 | 34/170 (20%) |
RRM_MTHFSD | 384..455 | CDD:240716 | |||
Mthfs | NP_081105.1 | 5-FTHF_cyc-lig | 10..198 | CDD:280059 | 46/220 (21%) |
Substrate binding. /evidence=ECO:0000250 | 148..152 | 2/3 (67%) | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG0212 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |