DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lost and Mthfs

DIOPT Version :9

Sequence 1:NP_649466.1 Gene:lost / 40559 FlyBaseID:FBgn0263594 Length:545 Species:Drosophila melanogaster
Sequence 2:NP_081105.1 Gene:Mthfs / 107885 MGIID:1340032 Length:203 Species:Mus musculus


Alignment Length:224 Identity:46/224 - (20%)
Similarity:80/224 - (35%) Gaps:72/224 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 IEPTKRSLRVQTWKKIQ--------------EGKVGIGFNNIFN--RIPSFVG-ADKAAALFANE 77
            :...||.||.:..::::              ..|| |..|...|  ||..|:. .|:.......:
Mouse     6 VNSAKRGLRAELKQRLRALSAEERLRQSLLLTQKV-IAHNQYQNSKRISIFLSMQDEVETEVIIK 69

  Fly    78 EEFKKA--------QHIKVNIDRV-LHEFKELALLADKS--VYLPSTRESSALCLKVDVLADATE 131
            :.||:.        |....::|.| |...:|:|||...|  ::.|..             .|..|
Mouse    70 DIFKQGKICFIPRYQFQSNHMDMVRLTSSEEIALLPKTSWNIHQPGE-------------GDVRE 121

  Fly   132 EQKKEALRVQDIQKFRSEIGLDSGLKLDIVVIGSVVVSREGYRIGRGNGFADLDIGLLIELGAIT 196
            |                  .|.:| .||::.:..:...::|.|:|||.|:.|..:...::...:.
Mouse   122 E------------------ALSTG-GLDLIFLPGLGFDKDGNRLGRGKGYYDTYLKRCVQHQEVK 167

  Fly   197 PKTIIVTI-----------VHDMQVVDSL 214
            |.|:.:..           .|||:|.:.|
Mouse   168 PYTMALAFKEQICPQIPVDEHDMKVDEVL 196

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lostNP_649466.1 5-FTHF_cyc-lig 67..238 CDD:294257 34/170 (20%)
RRM_MTHFSD 384..455 CDD:240716
MthfsNP_081105.1 5-FTHF_cyc-lig 10..198 CDD:280059 46/220 (21%)
Substrate binding. /evidence=ECO:0000250 148..152 2/3 (67%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0212
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.