DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lost and Mthfs

DIOPT Version :10

Sequence 1:NP_649466.1 Gene:lost / 40559 FlyBaseID:FBgn0263594 Length:545 Species:Drosophila melanogaster
Sequence 2:NP_081105.1 Gene:Mthfs / 107885 MGIID:1340032 Length:203 Species:Mus musculus


Alignment Length:224 Identity:46/224 - (20%)
Similarity:80/224 - (35%) Gaps:72/224 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 IEPTKRSLRVQTWKKIQ--------------EGKVGIGFNNIFN--RIPSFVG-ADKAAALFANE 77
            :...||.||.:..::::              ..|| |..|...|  ||..|:. .|:.......:
Mouse     6 VNSAKRGLRAELKQRLRALSAEERLRQSLLLTQKV-IAHNQYQNSKRISIFLSMQDEVETEVIIK 69

  Fly    78 EEFKKA--------QHIKVNIDRV-LHEFKELALLADKS--VYLPSTRESSALCLKVDVLADATE 131
            :.||:.        |....::|.| |...:|:|||...|  ::.|..             .|..|
Mouse    70 DIFKQGKICFIPRYQFQSNHMDMVRLTSSEEIALLPKTSWNIHQPGE-------------GDVRE 121

  Fly   132 EQKKEALRVQDIQKFRSEIGLDSGLKLDIVVIGSVVVSREGYRIGRGNGFADLDIGLLIELGAIT 196
            |                  .|.:| .||::.:..:...::|.|:|||.|:.|..:...::...:.
Mouse   122 E------------------ALSTG-GLDLIFLPGLGFDKDGNRLGRGKGYYDTYLKRCVQHQEVK 167

  Fly   197 PKTIIVTI-----------VHDMQVVDSL 214
            |.|:.:..           .|||:|.:.|
Mouse   168 PYTMALAFKEQICPQIPVDEHDMKVDEVL 196

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lostNP_649466.1 5-FTHF_cyc-lig 34..232 CDD:444864 46/220 (21%)
RRM_SF 384..455 CDD:473069
MthfsNP_081105.1 5-FTHF_cyc-lig 10..198 CDD:396398 46/220 (21%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.