DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14647 and Kctd17

DIOPT Version :9

Sequence 1:NP_649465.6 Gene:CG14647 / 40558 FlyBaseID:FBgn0037244 Length:335 Species:Drosophila melanogaster
Sequence 2:XP_006521523.3 Gene:Kctd17 / 72844 MGIID:1920094 Length:435 Species:Mus musculus


Alignment Length:134 Identity:58/134 - (43%)
Similarity:82/134 - (61%) Gaps:12/134 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 DAAPAAGDFVAASGFAP----NRWVKLNVGGQIYATTIDTLVGREPDSMLARMFLQNGSMKPSER 76
            :|||..|     :|..|    .:||:|||||.::.||..||. ||..|.|:|  |..|....|:|
Mouse    86 EAAPPVG-----AGGRPGGGWGKWVRLNVGGTVFLTTRQTLC-REQKSFLSR--LCQGEELQSDR 142

  Fly    77 DEQGAYLIDRSPRYFEPIINYLRHGQFVCDSNISVLGVLEEARFFGIFSLVTHLEERLGQQETPL 141
            ||.|||||||.|.||.||:|:||||:.|.|.:::..||||||.|:.|..|:..:::|:.:::..:
Mouse   143 DETGAYLIDRDPTYFGPILNFLRHGKLVLDKDMAEEGVLEEAEFYNIGPLIRIIKDRMEEKDYTV 207

  Fly   142 GDRP 145
            ...|
Mouse   208 AQVP 211

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14647NP_649465.6 BTB 35..138 CDD:197585 51/102 (50%)
BTB 36..126 CDD:295341 48/89 (54%)
Pentapeptide_4 160..241 CDD:290330
Pentapeptide 166..202 CDD:279183
Pentapeptide 204..243 CDD:279183
Pentapeptide_4 248..321 CDD:290330
Pentapeptide 249..287 CDD:279183
Pentapeptide 284..322 CDD:279183
Kctd17XP_006521523.3 BTB_POZ_KCTD17 103..203 CDD:349699 51/102 (50%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D545341at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.