DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14647 and Kctd2

DIOPT Version :9

Sequence 1:NP_649465.6 Gene:CG14647 / 40558 FlyBaseID:FBgn0037244 Length:335 Species:Drosophila melanogaster
Sequence 2:XP_008766633.1 Gene:Kctd2 / 498024 RGDID:1566063 Length:263 Species:Rattus norvegicus


Alignment Length:128 Identity:59/128 - (46%)
Similarity:74/128 - (57%) Gaps:1/128 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 PAAGDFVAASGFAPNRWVKLNVGGQIYATTIDTLVGREPDSMLARMFLQNGSMKPSERDEQGAYL 83
            |..|......|....|||:|||||..:.||..|| ||||.|.|.|:..|......|::||.||||
  Rat    57 PGPGPPERTGGGGAARWVRLNVGGTYFVTTRQTL-GREPKSFLCRLCCQEDPELDSDKDETGAYL 120

  Fly    84 IDRSPRYFEPIINYLRHGQFVCDSNISVLGVLEEARFFGIFSLVTHLEERLGQQETPLGDRPL 146
            |||.|.||.||:||||||:.:....::..||||||.|:.|.|||..::||:...|......|:
  Rat   121 IDRDPTYFGPILNYLRHGKLIITKELAEEGVLEEAEFYNIASLVRLVKERIRDNENRTSQGPV 183

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14647NP_649465.6 BTB 35..138 CDD:197585 53/102 (52%)
BTB 36..126 CDD:295341 47/89 (53%)
Pentapeptide_4 160..241 CDD:290330
Pentapeptide 166..202 CDD:279183
Pentapeptide 204..243 CDD:279183
Pentapeptide_4 248..321 CDD:290330
Pentapeptide 249..287 CDD:279183
Pentapeptide 284..322 CDD:279183
Kctd2XP_008766633.1 BTB 73..175 CDD:197585 53/102 (52%)
BTB_2 74..163 CDD:280393 47/89 (53%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D545341at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.