DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14647 and salto

DIOPT Version :9

Sequence 1:NP_649465.6 Gene:CG14647 / 40558 FlyBaseID:FBgn0037244 Length:335 Species:Drosophila melanogaster
Sequence 2:NP_610756.2 Gene:salto / 36332 FlyBaseID:FBgn0061197 Length:832 Species:Drosophila melanogaster


Alignment Length:299 Identity:70/299 - (23%)
Similarity:121/299 - (40%) Gaps:75/299 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 LNVGGQIYATTIDTLVGREPDS--MLARMFLQNGSMKPSERDEQGAYLIDRSPRYFEPIINYLRH 100
            ||...::.|    ||...|.||  .|.:|:.|     .||:               |.:||.:  
  Fly   565 LNARSELIA----TLQKNEEDSRTKLDQMYYQ-----VSEK---------------ETLINQV-- 603

  Fly   101 GQFVCDSNISVLGVLEEARFFGIFSLVTHLEERLGQQETPLGDRPLTRNDVIKAI-IQTSVITEL 164
                 ::.:|    .:|..|:.::..:||.:..:.:||           .:||.: .|.|.::.|
  Fly   604 -----NNKLS----SKEEEFYNLYGTLTHKQREVRRQE-----------HIIKLLKEQNSRVSLL 648

  Fly   165 RFQGVNLSGADLRKLDFRNINFKYANMSHCNLSHTNLNYCCL---ERADLQYANLECAQLVSVR- 225
            |           ...|.||...: ..:.|  |.:...||..|   ...:..:..|...::.|:| 
  Fly   649 R-----------ANQDERNATME-EEIKH--LKNALRNYAKLIVGNMGEHFFEVLPAGEMESIRS 699

  Fly   226 --------GLCANMEGANLRGCNFEDPTGVRTNLEGVNLKGACLESSNMAGVNLRVANLKNANMK 282
                    ..|..::..||:..|.::|.....||:...|:...|:..|:...||:..||::|.::
  Fly   700 GGHPVRVDSSCKFLQEPNLQEPNLQEPNLQEPNLQDDTLQEPNLQEPNLQEPNLQEPNLQDAILQ 764

  Fly   283 NCNLRAAVLAGADLEKCNLSGSDLQEANLRGANLKDAEL 321
            ..||:...|..|.|::.||..:.|||.||:.|.|::..|
  Fly   765 EPNLQEPNLQDATLQEPNLQDATLQELNLQDATLQEPNL 803

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14647NP_649465.6 BTB 35..138 CDD:197585 21/101 (21%)
BTB 36..126 CDD:295341 19/89 (21%)
Pentapeptide_4 160..241 CDD:290330 16/92 (17%)
Pentapeptide 166..202 CDD:279183 5/35 (14%)
Pentapeptide 204..243 CDD:279183 8/50 (16%)
Pentapeptide_4 248..321 CDD:290330 24/72 (33%)
Pentapeptide 249..287 CDD:279183 11/37 (30%)
Pentapeptide 284..322 CDD:279183 15/38 (39%)
saltoNP_610756.2 DUF1640 <313..422 CDD:285090
BAR <518..670 CDD:299863 34/164 (21%)
YjbI <713..803 CDD:224276 28/89 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR14136
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.