DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG14647 and kctd5a

DIOPT Version :9

Sequence 1:	NP_649465.6	Gene:	CG14647 / 40558	FlyBaseID:	FBgn0037244	Length:	335	Species:	Drosophila melanogaster
Sequence 2:	NP_996932.1	Gene:	kctd5a / 322008	ZFINID:	ZDB-GENE-030131-727	Length:	224	Species:	Danio rerio

Alignment Length:	139	Identity:	57/139 - (41%)
Similarity:	88/139 - (63%)	Gaps:	3/139 - (2%)

- Green bases have known domain annotations that are detailed below.

  Fly     8 SGSGARKDDAAPAAGDFVAASGFAPNRWVKLNVGGQIYATTIDTLVGREPDSMLARMFLQNGSMK 72
            |||..|: ..||:.|:.:..||...::||:|||||..:.||..||. |:|.|.|.|:...:..:
Zfish     9 SGSNGRR-CPAPSPGERLQPSGSGSSKWVRLNVGGTYFLTTRQTLC-RDPKSFLYRLCQADPDL- 70

  Fly    73 PSERDEQGAYLIDRSPRYFEPIINYLRHGQFVCDSNISVLGVLEEARFFGIFSLVTHLEERLGQQ 137
            .|::||.|||||||.|.||.|::||||||:.|.:..::..||||||.|:.|.||:..:::::.::
Zfish    71 DSDKDETGAYLIDRDPTYFGPVLNYLRHGKLVLNRGLAEEGVLEEAEFYNITSLIKLVKDKIRER 135

  Fly   138 ETPLGDRPL 146
            :......|:
Zfish   136 DCKTAQLPV 144

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG14647	NP_649465.6	BTB	35..138	CDD:197585	47/102 (46%)
		BTB	36..126	CDD:295341	44/89 (49%)
		Pentapeptide_4	160..241	CDD:290330
		Pentapeptide	166..202	CDD:279183
		Pentapeptide	204..243	CDD:279183
		Pentapeptide_4	248..321	CDD:290330
		Pentapeptide	249..287	CDD:279183
		Pentapeptide	284..322	CDD:279183
kctd5a	NP_996932.1	BTB	35..135	CDD:197585	47/101 (47%)
kctd5a	NP_996932.1	BTB_2	36..125	CDD:280393	45/90 (50%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	1	1.010	-	-		D545341at33208
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
ZFIN	0	0.000	Not matched by this tool.
	2	1.920