DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14647 and inc

DIOPT Version :9

Sequence 1:NP_649465.6 Gene:CG14647 / 40558 FlyBaseID:FBgn0037244 Length:335 Species:Drosophila melanogaster
Sequence 2:NP_001284786.1 Gene:inc / 31110 FlyBaseID:FBgn0025394 Length:211 Species:Drosophila melanogaster


Alignment Length:168 Identity:64/168 - (38%)
Similarity:94/168 - (55%) Gaps:31/168 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 NRWVKLNVGGQIYATTIDTLVGREPDSMLARMFLQNGSMKPSERDEQGAYLIDRSPRYFEPIINY 97
            ::||||||||..:.||..|| .|:|:|.|:|: :|......|:|||.|||||||.|:||.|::||
  Fly    21 DQWVKLNVGGTYFLTTKTTL-SRDPNSFLSRL-IQEDCDLISDRDETGAYLIDRDPKYFAPVLNY 83

  Fly    98 LRHGQFVCDSNISVLGVLEEARFFGIFSLVTHLEERLGQQETPLGDRPLTRNDVIKAIIQ----- 157
            ||||:.|.| .:|..||||||.|:.:..|:..|:|.:..::    .||.|....:..::|     
  Fly    84 LRHGKLVLD-GVSEEGVLEEAEFYNVTQLIALLKECILHRD----QRPQTDKKRVYRVLQCREQE 143

  Fly   158 -TSVITEL----RFQGVNLSGADLRKLDFRNINFKYAN 190
             |.:|:.|    ||:.:              |:.:|.|
  Fly   144 LTQMISTLSDGWRFEQL--------------ISMQYTN 167

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14647NP_649465.6 BTB 35..138 CDD:197585 52/102 (51%)
BTB 36..126 CDD:295341 48/89 (54%)
Pentapeptide_4 160..241 CDD:290330 7/35 (20%)
Pentapeptide 166..202 CDD:279183 4/25 (16%)
Pentapeptide 204..243 CDD:279183
Pentapeptide_4 248..321 CDD:290330
Pentapeptide 249..287 CDD:279183
Pentapeptide 284..322 CDD:279183
incNP_001284786.1 BTB 23..122 CDD:197585 52/101 (51%)
BTB_2 24..112 CDD:280393 48/90 (53%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45446527
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D104571at50557
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.850

Return to query results.
Submit another query.