DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14647 and F22E5.6

DIOPT Version :9

Sequence 1:NP_649465.6 Gene:CG14647 / 40558 FlyBaseID:FBgn0037244 Length:335 Species:Drosophila melanogaster
Sequence 2:NP_494320.2 Gene:F22E5.6 / 184835 WormBaseID:WBGene00017705 Length:225 Species:Caenorhabditis elegans


Alignment Length:104 Identity:34/104 - (32%)
Similarity:52/104 - (50%) Gaps:25/104 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 VKLNVGGQIYATTIDTLVGREPDSMLARMFLQNGSMK-------PSERDEQGAYLIDRSPRYFEP 93
            ::||:||.|:.|:..||...:            |..|       |.::|:.....||||||:||.
 Worm     8 IRLNIGGTIFETSKSTLTKFD------------GFFKTLLETDIPIQKDDSNCIFIDRSPRHFEK 60

  Fly    94 IINYLRHG---QFVCDSNISVLGVLEEARFF---GIFSL 126
            |:||||.|   ..:.:|...|..:|:||:|:   |:..|
 Worm    61 ILNYLRDGADVDLLPESEKEVREILKEAQFYLLEGLMEL 99

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14647NP_649465.6 BTB 35..138 CDD:197585 34/104 (33%)
BTB 36..126 CDD:295341 33/102 (32%)
Pentapeptide_4 160..241 CDD:290330
Pentapeptide 166..202 CDD:279183
Pentapeptide 204..243 CDD:279183
Pentapeptide_4 248..321 CDD:290330
Pentapeptide 249..287 CDD:279183
Pentapeptide 284..322 CDD:279183
F22E5.6NP_494320.2 BTB_2 8..100 CDD:366986 34/104 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 54 1.000 Inparanoid score I4071
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.960

Return to query results.
Submit another query.