DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14647 and F22E5.6

DIOPT Version :10

Sequence 1:NP_649465.6 Gene:CG14647 / 40558 FlyBaseID:FBgn0037244 Length:335 Species:Drosophila melanogaster
Sequence 2:NP_494320.2 Gene:F22E5.6 / 184835 WormBaseID:WBGene00017705 Length:225 Species:Caenorhabditis elegans


Alignment Length:104 Identity:34/104 - (32%)
Similarity:52/104 - (50%) Gaps:25/104 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 VKLNVGGQIYATTIDTLVGREPDSMLARMFLQNGSMK-------PSERDEQGAYLIDRSPRYFEP 93
            ::||:||.|:.|:..||...:            |..|       |.::|:.....||||||:||.
 Worm     8 IRLNIGGTIFETSKSTLTKFD------------GFFKTLLETDIPIQKDDSNCIFIDRSPRHFEK 60

  Fly    94 IINYLRHG---QFVCDSNISVLGVLEEARFF---GIFSL 126
            |:||||.|   ..:.:|...|..:|:||:|:   |:..|
 Worm    61 ILNYLRDGADVDLLPESEKEVREILKEAQFYLLEGLMEL 99

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14647NP_649465.6 BTB_POZ_KCTD9 34..134 CDD:349677 34/104 (33%)
YjbI 161..322 CDD:440968
F22E5.6NP_494320.2 BTB_2 8..100 CDD:426665 34/104 (33%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.