Sequence 1: | NP_649465.6 | Gene: | CG14647 / 40558 | FlyBaseID: | FBgn0037244 | Length: | 335 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_494485.2 | Gene: | C17F4.8 / 182739 | WormBaseID: | WBGene00015914 | Length: | 207 | Species: | Caenorhabditis elegans |
Alignment Length: | 198 | Identity: | 51/198 - (25%) |
---|---|---|---|
Similarity: | 98/198 - (49%) | Gaps: | 28/198 - (14%) |
- Green bases have known domain annotations that are detailed below.
Fly 36 VKLNVGGQIYATTIDTLVGREPDSML---ARMFLQNGSMKPSERDEQGAYLIDRSPRYFEPIINY 97
Fly 98 LRHGQF-VCDSNISVLGVLEEARFFGIFSLVTHLEERLGQQETPL--GDRPL---TRNDVIKAII 156
Fly 157 QTSVITELRFQGVNLSGADLRKLDFRNINFKYANMSHCNLSHTNLNYCCLERADLQYANLECAQL 221
Fly 222 VSV 224 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG14647 | NP_649465.6 | BTB | 35..138 | CDD:197585 | 33/105 (31%) |
BTB | 36..126 | CDD:295341 | 31/93 (33%) | ||
Pentapeptide_4 | 160..241 | CDD:290330 | 12/65 (18%) | ||
Pentapeptide | 166..202 | CDD:279183 | 6/35 (17%) | ||
Pentapeptide | 204..243 | CDD:279183 | 5/21 (24%) | ||
Pentapeptide_4 | 248..321 | CDD:290330 | |||
Pentapeptide | 249..287 | CDD:279183 | |||
Pentapeptide | 284..322 | CDD:279183 | |||
C17F4.8 | NP_494485.2 | BTB_2 | 8..98 | CDD:366986 | 33/97 (34%) |
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 1 | 1.000 | - | - | ||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 1 | 1.050 | 54 | 1.000 | Inparanoid score | I4071 |
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
3 | 2.960 |