DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14647 and C17F4.8

DIOPT Version :9

Sequence 1:NP_649465.6 Gene:CG14647 / 40558 FlyBaseID:FBgn0037244 Length:335 Species:Drosophila melanogaster
Sequence 2:NP_494485.2 Gene:C17F4.8 / 182739 WormBaseID:WBGene00015914 Length:207 Species:Caenorhabditis elegans


Alignment Length:198 Identity:51/198 - (25%)
Similarity:98/198 - (49%) Gaps:28/198 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 VKLNVGGQIYATTIDTLVGREPDSML---ARMFLQNGSMKPSERDEQGAYLIDRSPRYFEPIINY 97
            |||||||.::.|:..||      :|:   .:|.|:  |..|.::|:.....|||||::|:.|:|:
 Worm     8 VKLNVGGTVFQTSKSTL------TMIDGFFKMMLE--SDIPLQKDDSNCIFIDRSPKHFDIILNF 64

  Fly    98 LRHGQF-VCDSNISVLGVLEEARFFGIFSLVTHLEERLGQQETPL--GDRPL---TRNDVIKAII 156
            ||.|.. :.:....:..|..||:|:.:..||.....::..:...|  |...:   |:||..:.:|
 Worm    65 LRDGDVDLPEQEKEINEVKREAQFYLLEELVDLCHRKINTKIRVLISGTEKIEFYTKNDKPRLLI 129

  Fly   157 QTSVITELRFQGVNLSGADLRKLDFRNINFKYANMSHCNLSHTNLNYCCLERADLQYANLECAQL 221
                    ::...||..:.:..:|:.::..||.:..|  ::....|.|.|. |:.|:.:::.:..
 Worm   130 --------KYPEKNLDESPILDIDWGSLMEKYRDQFH--IAFAPQNNCSLS-ANCQFKSVKSSIF 183

  Fly   222 VSV 224
            :|:
 Worm   184 LSI 186

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14647NP_649465.6 BTB 35..138 CDD:197585 33/105 (31%)
BTB 36..126 CDD:295341 31/93 (33%)
Pentapeptide_4 160..241 CDD:290330 12/65 (18%)
Pentapeptide 166..202 CDD:279183 6/35 (17%)
Pentapeptide 204..243 CDD:279183 5/21 (24%)
Pentapeptide_4 248..321 CDD:290330
Pentapeptide 249..287 CDD:279183
Pentapeptide 284..322 CDD:279183
C17F4.8NP_494485.2 BTB_2 8..98 CDD:366986 33/97 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 54 1.000 Inparanoid score I4071
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.960

Return to query results.
Submit another query.