DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9855 and AT3G47550

DIOPT Version :10

Sequence 1:NP_649463.2 Gene:CG9855 / 40556 FlyBaseID:FBgn0037242 Length:382 Species:Drosophila melanogaster
Sequence 2:NP_190339.1 Gene:AT3G47550 / 823909 AraportID:AT3G47550 Length:288 Species:Arabidopsis thaliana


Alignment Length:96 Identity:28/96 - (29%)
Similarity:40/96 - (41%) Gaps:25/96 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 KATDASTSTAVQVAV--------DGGEP-----ERCCWICFATDEDNRLAAWVKPCQCRGTTKWV 93
            :.||.::|:..:..|        |..||     |  |.||...|....|.|   ||.|.|:.|:.
plant    35 QGTDLASSSVNETEVPREYYAVADEEEPLLQSVE--CRICQEEDSTKNLEA---PCACNGSLKYA 94

  Fly    94 HQSCLYRWIDEKTQKGNALRTVSCPQCQTEY 124
            |:.|:.||.:||..       ::|..|...|
plant    95 HRKCVQRWCNEKGD-------ITCEICHQPY 118

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9855NP_649463.2 RING_CH-C4HC3_MARCH5 63..124 CDD:438361 19/60 (32%)
AT3G47550NP_190339.1 RINGv 69..115 CDD:128983 18/55 (33%)
DUF3675 121..237 CDD:463576
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.