DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9855 and AT2G02960

DIOPT Version :10

Sequence 1:NP_649463.2 Gene:CG9855 / 40556 FlyBaseID:FBgn0037242 Length:382 Species:Drosophila melanogaster
Sequence 2:NP_973407.1 Gene:AT2G02960 / 814825 AraportID:AT2G02960 Length:275 Species:Arabidopsis thaliana


Alignment Length:91 Identity:26/91 - (28%)
Similarity:39/91 - (42%) Gaps:17/91 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 PASANKATDAST---STAVQVAVDGGEPERCCWICFATDEDNRLAAWVKPCQCRGTTKWVHQSCL 98
            |...:||.|.|.   ....:..:..||    |.||   .:::.:.....||.|.|:.|:.|:.|:
plant    16 PVVNDKALDISDDDHDDENEPLIVSGE----CRIC---SDESPVENLESPCACSGSLKYAHRKCV 73

  Fly    99 YRWIDEKTQKGNALRTVSCPQCQTEY 124
            .||.:|   |||    :.|..|...|
plant    74 QRWCNE---KGN----IICEICHQPY 92

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9855NP_649463.2 RING_CH-C4HC3_MARCH5 63..124 CDD:438361 18/60 (30%)
AT2G02960NP_973407.1 RINGv 43..89 CDD:128983 17/55 (31%)
DUF3675 94..>176 CDD:463576
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.