DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cont and BSG

DIOPT Version :10

Sequence 1:NP_649461.2 Gene:Cont / 40553 FlyBaseID:FBgn0037240 Length:1390 Species:Drosophila melanogaster
Sequence 2:NP_001719.2 Gene:BSG / 682 HGNCID:1116 Length:385 Species:Homo sapiens


Alignment Length:355 Identity:76/355 - (21%)
Similarity:118/355 - (33%) Gaps:117/355 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   579 FPEAPVA-----GDEIRLECMAFGYPIPSYNWTRQ-------------GLPLQR----NAYTINY 621
            |.:||::     |..:.|.|.|.|.|:|...|..:             |..|.|    ..|..:.
Human    25 FVQAPLSQQRWVGGSVELHCEAVGSPVPEIQWWFEGQGPNDTCSQLWDGARLDRVHIHATYHQHA 89

  Fly   622 GRVLIIQNATTNDNGEYSCTITN----------PRKTLMKSIYINIQMRP--QFTIPLKDMIKDY 674
            ...:.|......|.|.|.|..:|          ||...:::..:.:.:.|  .||     .::|.
Human    90 ASTISIDTLVEEDTGTYECRASNDPDRNHLTRAPRVKWVRAQAVVLVLEPGTVFT-----TVEDL 149

  Fly   675 NSDVTFICEA--FAIPDANYTWYKNAERLDPANINRDRYIIQDNVLTIKFLE--KDKDD--AMYQ 733
            .|.:...|..  .|.....:.|.|..            .:::::.|..:..|  .|.||  ..|.
Human   150 GSKILLTCSLNDSATEVTGHRWLKGG------------VVLKEDALPGQKTEFKVDSDDQWGEYS 202

  Fly   734 C-------GAQNQLKTSFSSAQL----RVLSMKPSFKKHPLESEVYAVYNGNTTIVCDPEAAPRP 787
            |       |..|        .||    ||.::|.|  :|..|.|       ...:||..|:.| |
Human   203 CVFLPEPMGTAN--------IQLHGPPRVKAVKSS--EHINEGE-------TAMLVCKSESVP-P 249

  Fly   788 KFQW------KKDGQVIGSGGHRRILPSGT-----LTISPTSRD-DEGIYTCIASNQAGTDE--- 837
            ...|      ..:.:.:.:|...|...|.:     |.|...:.: |.|.|.|..::..|:|:   
Human   250 VTDWAWYKITDSEDKALMNGSESRFFVSSSQGRSELHIENLNMEADPGQYRCNGTSSKGSDQAII 314

  Fly   838 -----SH-----------ARVIVLQEIRFI 851
                 ||           |.|:||..|.||
Human   315 TLRVRSHLAALWPFLGIVAEVLVLVTIIFI 344

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ContNP_649461.2 CLECT 139..>223 CDD:214480
Ig 361..466 CDD:472250
Ig strand B 384..388 CDD:409356
Ig strand C 397..409 CDD:409356
Ig strand E 428..432 CDD:409356
Ig strand F 443..448 CDD:409356
Ig strand G 457..460 CDD:409356
Ig 474..559 CDD:472250
Ig strand B 485..489 CDD:409392
Ig strand C 499..503 CDD:409392
Ig strand E 523..527 CDD:409392
Ig strand F 537..542 CDD:409392
Ig strand G 553..556 CDD:409392
Ig_3 584..644 CDD:464046 17/81 (21%)
Ig_3 660..738 CDD:464046 17/92 (18%)
Ig 756..844 CDD:472250 25/118 (21%)
Ig strand B 775..779 CDD:409358 0/3 (0%)
Ig strand C 788..792 CDD:409358 1/9 (11%)
Ig strand E 810..814 CDD:409358 1/8 (13%)
Ig strand F 824..829 CDD:409358 2/4 (50%)
Ig strand G 837..840 CDD:409358 2/21 (10%)
Ig <868..944 CDD:472250
Ig strand C 881..885 CDD:409359
Ig strand E 906..910 CDD:409359
Ig strand F 920..925 CDD:409359
Ig strand G 933..936 CDD:409359
FN3 944..1043 CDD:238020
FN3 1053..1146 CDD:238020
fn3 1156..1244 CDD:394996
fn3 1259..1346 CDD:394996
BSGNP_001719.2 Ig0_BSG1 23..138 CDD:409534 23/112 (21%)
Ig strand A 24..28 CDD:409534 1/2 (50%)
Ig strand A' 29..35 CDD:409534 1/5 (20%)
Ig strand B 38..47 CDD:409534 2/8 (25%)
Ig strand C 52..60 CDD:409534 2/7 (29%)
Ig strand C' 65..69 CDD:409534 0/3 (0%)
Ig strand D 79..85 CDD:409534 0/5 (0%)
Ig strand E 88..97 CDD:409534 1/8 (13%)
Ig strand F 104..112 CDD:409534 3/7 (43%)
Ig strand G 128..138 CDD:409534 0/9 (0%)
Essential for interaction with KDR/VEGFR2. /evidence=ECO:0000269|PubMed:25825981 195..199 2/3 (67%)
IG_like 228..318 CDD:214653 21/99 (21%)
Ig strand B 238..242 CDD:409353 0/3 (0%)
Ig strand E 283..287 CDD:409353 1/3 (33%)
Ig strand F 298..303 CDD:409353 2/4 (50%)
Ig strand G 311..314 CDD:409353 0/2 (0%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 353..385
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.