DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cont and hmcn2

DIOPT Version :10

Sequence 1:NP_649461.2 Gene:Cont / 40553 FlyBaseID:FBgn0037240 Length:1390 Species:Drosophila melanogaster
Sequence 2:XP_001920501.5 Gene:hmcn2 / 565032 ZFINID:ZDB-GENE-030131-9765 Length:4212 Species:Danio rerio


Alignment Length:1341 Identity:273/1341 - (20%)
Similarity:471/1341 - (35%) Gaps:355/1341 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   203 ISARQTGPLNWVNDDNTQLVQIEDSFSMDEQVPLENEDLH----DNRFLVQNDLNNQNINNPNQF 263
            :|...:..::|:.|.                :||.::..|    |.:.|   ::.|..:::    
Zfish  1861 VSGHPSPSVSWIKDG----------------LPLYSDSRHNILEDGKLL---EIVNVQVSD---- 1902

  Fly   264 YNSLPGTVNQRNQNNLRGFIGPNQPYGDNRYVRDRVVYAFSKKRDRWMFMPAYEIELNLFICESK 328
                 |...|....|..|.:  .:.|..:..|..|:|   .::.:....:..:.|.|   :|:.:
Zfish  1903 -----GASYQCVAENKAGAV--ERLYSLSIQVPPRIV---GRREEEMSVVEGHMISL---LCDVQ 1954

  Fly   329 VLYSSDNVNIKLDDKRPYHYGLDI---NDMERIPR------GPYFVKQPNDTTFDVNKNRLI--- 381
            ....:|.:..|......:..|:.|   ..|.:|||      |.|.....|....| .|:.|:   
Zfish  1955 AYPPADIIWTKDGQMLEFTTGIHILPGGQMLQIPRAGQQDAGQYVCTATNSAGQD-QKSILLTIY 2018

  Fly   382 ---------------------NDVTLSCLANGYPTPSYTWYR---EVYVDD--RLEYQKIDPLAQ 420
                                 :.:.|.|.|||.|.|..||||   ::...:  |:|.|:::    
Zfish  2019 ALPALVPRLESESEVRTPLVGSTLILRCEANGIPKPEVTWYRNGLQLAAGNGLRIERQQLE---- 2079

  Fly   421 DRYTISGGNLIIYEPKQALDQGAYHCVAENKFGRI-RSESAHLNFGFIMEFNLKRSAETSEMNWG 484
                |.|        .|..|.|.|.|...|..|:: |:....::...:||..|.   ||...|.|
Zfish  2080 ----IVG--------VQVADGGVYTCKVSNIAGQVDRTFRVTVHVPPVMEGPLH---ETLTQNLG 2129

  Fly   485 K--SIFCDPPQHYPDVRYYWARDYFPNFVEED-QRVFVSRDGALYFSFIETVDRANYSCTVQTLV 546
            .  ::.|: ....|.....|.:|..|  :|.. |..:.:|...|....::......|:|..:...
Zfish  2130 SHITLICE-ASGIPVPNIAWLKDGSP--IESSLQWNWSTRANRLELGPLQLSHAGTYTCIAKNTE 2191

  Fly   547 SDTGRNGPFFPLRVTPNSNYQALIFANTFPKVFP-------EAPVAGDEIRLECMAFGYPIPSYN 604
            ..|             ..:|...|:|.  |.:..       .||| |:|:.|||.|.|.|.|..:
Zfish  2192 GQT-------------QKDYSLTIYAP--PSIIDSGHPSEVSAPV-GEELALECRAMGSPAPKVS 2240

  Fly   605 WTRQGLPL-QRNAYTINY---GRVLIIQNATTNDNGEYSCTITNPRKTLMKSIYINIQMRP---- 661
            |.|.|..| ..|...||.   |..|...:....|:|.|:|...:......| ||....:.|    
Zfish  2241 WLRNGKTLVNGNTEHINISPDGSTLTFLSVKPEDSGTYTCLAVSSAGQETK-IYTLFALVPPSIS 2304

  Fly   662 -QFTIPLKDMIKDYNSDVTFICEAFAIPDANYTWYKNAE--RLDPANINRDRYIIQDNVLTIKFL 723
             :.::| :::....:|.||..|:|...|....:|.::..  .|.|    |.|.:..|:.|.|..:
Zfish  2305 GETSVP-REVHTTQHSVVTLECKAKGTPQPQISWLRDGHPLLLSP----RIRLLSADSTLRISPV 2364

  Fly   724 EKDKDDAMYQCGAQNQLKTSFSSAQLRVLSMKPSFKKHPLESEVYAVYNGNTTIVCDPEAAPRPK 788
            .. .|..:|.|.|:::...:..:..|:|.:.....:..|.| :|..|...:.|:.|:....|.|.
Zfish  2365 HL-SDSGIYTCVARSRAGLAELNFDLQVQAPPAVERTEPTE-QVAVVQGSSVTLTCEARGVPPPT 2427

  Fly   789 FQWKKDGQVIGSGGHRRILPSGTLT---ISPTSRDDEGIYTCIASNQAGTDESHARVIVLQEIRF 850
            ..|.||||.:..  ||.:|..|..|   :|.....|.|:|:|:||||||:......:.||:    
Zfish  2428 LSWLKDGQPLSL--HRNLLLDGQETRFLLSDVGPSDAGLYSCVASNQAGSSTKTFNLTVLE---- 2486

  Fly   851 IETPPQ--RIVSKEHDLIFLHCEAAFDELLDIAYV----------WKHNGEVLKNNHDGTGRIIV 903
               ||:  ..:|.|..||      |.|.||::..:          |..:|..:::|   ...|..
Zfish  2487 ---PPKITGSLSPEEQLI------AVDSLLELECIATGLPPPTLSWLKDGRPIQDN---MAIIER 2539

  Fly   904 DWNRLTVHNTSMRDAGDYECVVKSAVNEISSKTSVSIEGAPGAPGGVQVIQIS---KTKAIIEWV 965
            |...|.::...:.|||.|.|:..|...|......|.::..|...|...:..:|   |....:|..
Zfish  2540 DGQLLRINKVQVEDAGLYTCLASSPAGEDGRNHWVRVQLPPTLLGSNDIRTVSVPAKGHLTLECQ 2604

  Fly   966 DGSHNGRAIRYYNILGRTNWNRTWVNVSTHVQAREVDRYTSRQQAEVVNLTPWSAYEFSVTAVND 1030
            ..|.....|.:|.           .||...:..| :....|.|..|:.::....:.::|....|.
Zfish  2605 TDSDPPPEIEWYK-----------DNVKVQLGGR-IQSIASGQFLEIQDVRMHDSGQYSCVVTNI 2657

  Fly  1031 LGIGTPSAPSPIYSTYEDKPYIAPRNVGGGGGKIGDLTITWDPLLPQEQHSHGIHYKVFWKLKGA 1095
            .|      .:.::.|.|   .:.|..:..|...| ...:..|.:||.|             ::||
Zfish  2658 AG------STSLFFTVE---ILLPPVIREGSSLI-IAHVGQDAVLPCE-------------VEGA 2699

  Fly  1096 ----IEWASD-----------EIKKQDHMGVAVVNI-PLNNYYTE-----------YEVKVQAIN 1133
                :.|..|           .:..:..:.::.|.: .:..||..           .::||....
Zfish  2700 PSSSVMWRKDGGPVPLHNNRFTLLSEGSLRISTVQLSDVGRYYCSVSNQAGSDHRGMDLKVYVGP 2764

  Fly  1134 SVGKGPESEIAV-----IHSAEDMPQVAPQKPIALAYNSTCFNVTWQ----PIDMSRENI----- 1184
            |:..||.:...|     :.|.|.....|||             |:|:    ||.:.:.:.     
Zfish  2765 SISPGPFNVTVVTGQRAVLSCESTGIPAPQ-------------VSWRRNGSPISVDQSSAYRLMS 2816

  Fly  1185 RGKLIGHRLKYWKTTHQEEDSVYYLSRTT-------RNWALIVGLQP------DTYYFVK----V 1232
            .|.|:       .|:...||..|:....|       |...:|:.:.|      .:...||    |
Zfish  2817 SGSLV-------ITSPTAEDEGYFECTVTNEVGEERRVIEVILQVPPVIKDDVSSVTAVKMSPVV 2874

  Fly  1233 MAYNAAGEGPESERFEERTYRKAPQK-------PPSSVHVYGINPS-----------TVRVVWRY 1279
            :..:|.|. ||......:.:.:...:       |..::.:....||           .|.|.:::
Zfish  2875 LPCHATGR-PEPVISWNKNWMQLGARGGSYRVLPTGALEILAATPSHAGKYTCSARNPVGVAYKH 2938

  Fly  1280 VSPSQDEEPVEGYKVRIWESDQNMITANNTIVPIGQKLESYINNLTPGKSYNMRVLAYSNGGDGR 1344
            |:.:..|.|    ::|....:..::..::.::|.  :::.:                        
Zfish  2939 VTLTVQEPP----EIRPMAEEVQVVLHHSVVLPC--EVQGF------------------------ 2973

  Fly  1345 MSSPTLHFQMGKTTRNGANTRHGHNI----NTALILSTLLL 1381
             ..||:.:|     |.|.....||.:    |.||..|.:.|
Zfish  2974 -PRPTITWQ-----REGVPVATGHRLAVLSNGALKFSRVTL 3008

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ContNP_649461.2 CLECT 139..>223 CDD:214480 3/19 (16%)
Ig 361..466 CDD:472250 30/134 (22%)
Ig strand B 384..388 CDD:409356 1/3 (33%)
Ig strand C 397..409 CDD:409356 4/16 (25%)
Ig strand E 428..432 CDD:409356 0/3 (0%)
Ig strand F 443..448 CDD:409356 2/4 (50%)
Ig strand G 457..460 CDD:409356 0/2 (0%)
Ig 474..559 CDD:472250 16/87 (18%)
Ig strand B 485..489 CDD:409392 0/5 (0%)
Ig strand C 499..503 CDD:409392 0/3 (0%)
Ig strand E 523..527 CDD:409392 1/3 (33%)
Ig strand F 537..542 CDD:409392 2/4 (50%)
Ig strand G 553..556 CDD:409392 0/2 (0%)
Ig_3 584..644 CDD:464046 23/63 (37%)
Ig_3 660..738 CDD:464046 20/84 (24%)
Ig 756..844 CDD:472250 29/90 (32%)
Ig strand B 775..779 CDD:409358 1/3 (33%)
Ig strand C 788..792 CDD:409358 0/3 (0%)
Ig strand E 810..814 CDD:409358 2/6 (33%)
Ig strand F 824..829 CDD:409358 2/4 (50%)
Ig strand G 837..840 CDD:409358 0/2 (0%)
Ig <868..944 CDD:472250 18/85 (21%)
Ig strand C 881..885 CDD:409359 0/13 (0%)
Ig strand E 906..910 CDD:409359 1/3 (33%)
Ig strand F 920..925 CDD:409359 2/4 (50%)
Ig strand G 933..936 CDD:409359 0/2 (0%)
FN3 944..1043 CDD:238020 17/101 (17%)
FN3 1053..1146 CDD:238020 20/124 (16%)
fn3 1156..1244 CDD:394996 23/113 (20%)
fn3 1259..1346 CDD:394996 10/97 (10%)
hmcn2XP_001920501.5 Ig strand F 1221..1226 CDD:409570
Ig strand G 1234..1237 CDD:409570
Ig 1245..1335 CDD:472250
Ig strand B 1263..1267 CDD:409570
Ig strand C 1276..1280 CDD:409570
Ig strand E 1301..1305 CDD:409570
Ig strand F 1315..1320 CDD:409570
Ig strand G 1328..1331 CDD:409570
Ig 1338..1430 CDD:472250
Ig strand B 1358..1362 CDD:409353
Ig strand C 1371..1375 CDD:409353
Ig strand E 1394..1398 CDD:409353
Ig strand F 1408..1413 CDD:409353
Ig strand G 1421..1424 CDD:409353
I-set 1443..1523 CDD:400151
Ig strand B 1451..1455 CDD:409353
Ig strand C 1464..1468 CDD:409353
Ig strand E 1488..1493 CDD:409353
Ig strand F 1503..1508 CDD:409353
I-set 1538..1608 CDD:400151
Ig strand B 1546..1550 CDD:409353
Ig strand C 1559..1563 CDD:409353
Ig strand E 1582..1586 CDD:409353
Ig strand F 1596..1601 CDD:409353
Ig strand G 1610..1613 CDD:409353
ChlD <21..206 CDD:440853
IG_like 441..512 CDD:214653
Ig 516..603 CDD:472250
Ig strand B 533..537 CDD:409353
Ig strand C 546..550 CDD:409353
Ig strand E 569..573 CDD:409353
Ig strand F 583..588 CDD:409353
Ig strand G 596..599 CDD:409353
Ig_3 607..680 CDD:464046
I-set 711..784 CDD:400151
Ig strand B 714..718 CDD:409353
Ig strand C 727..731 CDD:409353
Ig strand E 750..754 CDD:409353
Ig strand F 764..769 CDD:409353
Ig strand G 777..780 CDD:409353
IG_like 794..879 CDD:214653
Ig strand B 805..809 CDD:409353
Ig strand C 818..822 CDD:409353
Ig strand E 845..849 CDD:409353
Ig strand F 859..864 CDD:409353
Ig strand G 872..875 CDD:409353
Ig 885..972 CDD:472250
Ig strand C 916..920 CDD:409353
Ig strand E 938..942 CDD:409353
Ig strand F 952..957 CDD:409353
Ig strand G 965..968 CDD:409353
Ig_3 975..1049 CDD:464046
IG_like 1083..1159 CDD:214653
Ig strand B 1089..1093 CDD:409353
Ig strand C 1102..1106 CDD:409353
Ig strand E 1125..1129 CDD:409353
Ig strand F 1139..1144 CDD:409353
Ig strand G 1152..1155 CDD:409353
I-set 1163..1241 CDD:400151
Ig strand B 1180..1184 CDD:409570
Ig strand C 1193..1197 CDD:409570
Ig strand E 1208..1211 CDD:409570
Ig 1637..1714 CDD:472250
Ig strand B 1644..1648 CDD:409353
Ig strand C 1657..1661 CDD:409353
Ig strand E 1680..1684 CDD:409353
Ig strand F 1694..1699 CDD:409353
IG_like 1753..1830 CDD:214653
Ig strand B 1760..1764 CDD:409353
Ig strand C 1773..1777 CDD:409353
Ig strand E 1796..1800 CDD:409353
Ig strand F 1810..1815 CDD:409353
Ig strand G 1823..1826 CDD:409353
I-set 1834..1918 CDD:400151 13/86 (15%)
Ig strand B 1855..1859 CDD:409256
Ig strand C 1868..1872 CDD:409256 0/3 (0%)
Ig strand E 1891..1895 CDD:409256 1/6 (17%)
Ig strand F 1905..1910 CDD:409256 1/4 (25%)
Ig strand G 1918..1921 CDD:409256 0/2 (0%)
Ig 1939..2017 CDD:472250 17/81 (21%)
Ig strand B 1947..1951 CDD:409256 2/6 (33%)
Ig strand C 1960..1964 CDD:409256 1/3 (33%)
Ig strand E 1983..1987 CDD:409256 1/3 (33%)
Ig strand F 1997..2002 CDD:409256 1/4 (25%)
Ig strand G 2010..2013 CDD:409256 1/2 (50%)
I-set 2038..2110 CDD:400151 24/87 (28%)
Ig strand B 2042..2046 CDD:409353 1/3 (33%)
Ig strand C 2055..2059 CDD:409353 1/3 (33%)
Ig strand F 2090..2095 CDD:409353 2/4 (50%)
Ig_3 2113..2189 CDD:464046 18/81 (22%)
Ig_3 2205..2282 CDD:464046 26/79 (33%)
I-set 2307..2391 CDD:400151 20/89 (22%)
Ig strand B 2321..2325 CDD:409353 2/3 (67%)
Ig strand C 2334..2338 CDD:409353 0/3 (0%)
Ig strand E 2357..2361 CDD:409353 1/3 (33%)
Ig strand F 2371..2376 CDD:409353 2/4 (50%)
I-set 2400..2484 CDD:400151 29/86 (34%)
Ig strand B 2414..2418 CDD:409353 1/3 (33%)
Ig strand C 2427..2431 CDD:409353 0/3 (0%)
Ig strand E 2447..2454 CDD:409353 2/6 (33%)
Ig strand F 2464..2469 CDD:409353 2/4 (50%)
Ig_3 2487..2562 CDD:464046 21/83 (25%)
Ig 2599..2667 CDD:472250 13/85 (15%)
Ig strand B 2599..2603 CDD:409353 0/3 (0%)
Ig strand C 2612..2616 CDD:409353 1/3 (33%)
Ig strand E 2635..2639 CDD:409353 1/3 (33%)
Ig strand F 2649..2654 CDD:409353 1/4 (25%)
IG_like 2679..2760 CDD:214653 12/94 (13%)
Ig strand B 2690..2694 CDD:409353 1/3 (33%)
Ig strand C 2703..2707 CDD:409353 0/3 (0%)
Ig strand E 2726..2730 CDD:409353 0/3 (0%)
Ig strand F 2740..2745 CDD:409353 2/4 (50%)
Ig_3 2764..2839 CDD:464046 19/94 (20%)
Ig 2857..2943 CDD:472250 13/86 (15%)
Ig strand B 2873..2877 CDD:409353 1/3 (33%)
Ig strand C 2886..2890 CDD:409353 0/3 (0%)
Ig strand E 2909..2913 CDD:409353 0/3 (0%)
Ig strand F 2923..2928 CDD:409353 0/4 (0%)
Ig strand G 2936..2939 CDD:409353 0/2 (0%)
Ig_3 2946..3020 CDD:464046 15/99 (15%)
Ig_3 3036..3110 CDD:464046
IG_like 3133..3214 CDD:214653
Ig strand B 3144..3148 CDD:409353
Ig strand C 3157..3161 CDD:409353
Ig strand E 3180..3184 CDD:409353
Ig strand F 3194..3199 CDD:409353
Ig strand G 3207..3210 CDD:409353
Ig 3218..3293 CDD:472250
Ig strand B 3235..3239 CDD:409353
Ig strand C 3248..3252 CDD:409353
Ig strand E 3269..3273 CDD:409353
Ig strand F 3283..3288 CDD:409353
I-set 3316..3394 CDD:400151
Ig strand B 3325..3329 CDD:409353
Ig strand C 3338..3342 CDD:409353
Ig strand E 3360..3364 CDD:409353
Ig strand F 3374..3379 CDD:409353
Ig strand G 3387..3390 CDD:409353
TSP1 3401..3452 CDD:214559
G2F 3454..3636 CDD:462175
EGF_CA 3691..3721 CDD:214542
EGF_CA 3731..3775 CDD:214542
EGF_CA 3776..3814 CDD:214542
EGF_CA 3816..3849 CDD:238011
EGF_CA 3858..3889 CDD:429571
EGF_CA 3901..3940 CDD:214542
EGF_CA 4005..4044 CDD:214542
EGF_CA 4045..4085 CDD:214542
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.