DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cont and CNTN3

DIOPT Version :10

Sequence 1:NP_649461.2 Gene:Cont / 40553 FlyBaseID:FBgn0037240 Length:1390 Species:Drosophila melanogaster
Sequence 2:NP_065923.1 Gene:CNTN3 / 5067 HGNCID:2173 Length:1028 Species:Homo sapiens


Alignment Length:1017 Identity:331/1017 - (32%)
Similarity:481/1017 - (47%) Gaps:76/1017 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   356 ERIPRGPYFVKQPNDTTFDVNKNRLINDVTLSCLANGYPTPSYTWYREVYVDDRLEYQKIDPLAQ 420
            |.:.:||.|:|:|:::.|.|....  ..:||.|.|.|.|:|.|.|        :|....||...:
Human    20 ELLLQGPVFIKEPSNSIFPVGSED--KKITLHCEARGNPSPHYRW--------QLNGSDIDMSME 74

  Fly   421 DRYTISGGNLIIYEPKQALDQGAYHCVAENKFGRIRSESAHLNFGFIMEFNLK-RSAETSEMNWG 484
            .||.::||||::..|.:..|.|.|.|.|.|..|.|.|..|.|.|.::..|..| ||..:.....|
Human    75 HRYKLNGGNLVVINPNRNWDTGTYQCFATNSLGTIVSREAKLQFAYLENFKTKMRSTVSVREGQG 139

  Fly   485 KSIFCDPPQHYPDVRYYWARDYFPNFVEEDQRVFVSRD-GALYFSFIETVDRANYSCTVQTLVSD 548
            ..:.|.||.|..::.|.|..:.:|:|||||.|.|||:: |.||.|.:|..|..||:|.|.::|::
Human   140 VVLLCGPPPHSGELSYAWIFNEYPSFVEEDSRRFVSQETGHLYISKVEPSDVGNYTCVVTSMVTN 204

  Fly   549 TGRNGPFFPLRVTPNSNYQALIFANTFPKV---FPEA-PVA-GDEIRLECMAFGYPIPSYNWTR- 607
            ....|...||.:..:.     :.....||:   |||. |.| |..::|||.|.|.|||..||.| 
Human   205 ARVLGSPTPLVLRSDG-----VMGEYEPKIEVQFPETLPAAKGSTVKLECFALGNPIPQINWRRS 264

  Fly   608 QGLPLQRNAYTINYGRVLIIQNATTNDNGEYSCTITNPRKTLMKSIYINIQMRPQFTIPLKDMIK 672
            .|||.........:..||.|.|....|.|.|.|...|.|...:....:....:|.:...:||:..
Human   265 DGLPFSSKIKLRKFSGVLEIPNFQQEDAGSYECIAENSRGKNVARGRLTYYAKPHWVQLIKDVEI 329

  Fly   673 DYNSDVTFICEAFAIPDANYTWYKNAERLDPANINRDRYIIQDNVLTIKFLEKDKDDAMYQCGAQ 737
            .....:.:.|.|...|..:|.|.||...|    :..:|..|::..|||..|.. .|..|:||.|:
Human   330 AVEDSLYWECRASGKPKPSYRWLKNGAAL----VLEERTQIENGALTISNLSV-TDSGMFQCIAE 389

  Fly   738 NQLKTSFSSAQLRVLSMKPSFKKHPLESEVYAVYNGNTTIVCDPEAAPRPKFQWKKDGQVIGSGG 802
            |:....:|||:|:|::..|.|.|:|::..|........::.|.|.|:||....|||..  :....
Human   390 NKHGLVYSSAELKVVASAPDFSKNPMKKLVQVQVGSLVSLDCKPRASPRALSSWKKGD--VSVQE 452

  Fly   803 HRRI--LPSGTLTISPTSRDDEGIYTCIASNQAGTDESHARVIVLQEIRFIETPPQRIVSKEHDL 865
            |.||  |..|.|.|:..::.|.|.|||:|.||.|.......::|.:..|....|....||....:
Human   453 HERISLLNDGGLKIANVTKADAGTYTCMAENQFGKANGTTHLVVTEPTRITLAPSNMDVSVGESV 517

  Fly   866 IFLHCEAAFDELLDIAYVWKHNGEVLKNNHDGT------GRIIVDWNRLTVHNTSMRDAGDYECV 924
            | |.|:...|.||||.:.|..||.:.....||:      |....|   |.:.|..::.:|.|.|:
Human   518 I-LPCQVQHDPLLDIIFTWYFNGALADFKKDGSHFEKVGGSSSGD---LMIRNIQLKHSGKYVCM 578

  Fly   925 VKSAVNEISSKTSVSIEGAPGAPGGVQVIQISKTKAIIEWVDGSHNGRAIRYYNILGRTNWNRTW 989
            |::.|:.:||...:.:.|:||.|..|:|.:|:.|.|.:.|.:|..|...:..|:|..||.::..|
Human   579 VQTGVDSVSSAADLIVRGSPGPPENVKVDEITDTTAQLSWKEGKDNHSPVISYSIQARTPFSVGW 643

  Fly   990 VNVSTHVQAREVDRYTSRQQAEVVNLTPWSAYEFSVTAVNDLGIGTPSAPSPIYSTYEDKPYIAP 1054
            ..|:|..:..:...:|    |.||.|.||..|||.|.|.|.:|.|.||.||....|.|..|.:.|
Human   644 QTVTTVPEVIDGKTHT----ATVVELNPWVEYEFRVVASNKIGGGEPSLPSEKVRTEEAVPEVPP 704

  Fly  1055 RNVGGGGGKIGDLTITWDPLLPQEQHSHGIHYKVFWKLKGAIEWASDEIKKQDHMGVAVVN---I 1116
            ..|.||||...:|.|||||:..:.|:..|..|.|.::..|...|....:...|.......|   :
Human   705 SEVNGGGGSRSELVITWDPVPEELQNGEGFGYVVAFRPLGVTTWIQTVVTSPDTPRYVFRNESIV 769

  Fly  1117 PLNNYYTEYEVKVQAINSVGKGPESEIAVIHSAEDMPQVAPQKPIALAYNSTCFNVTWQPIDMSR 1181
            |    |:.|||||...|:.|:||.|.:..:.|||:.|.|||.:..|.:.:|:...|:|..|....
Human   770 P----YSPYEVKVGVYNNKGEGPFSPVTTVFSAEEEPTVAPSQVSANSLSSSEIEVSWNTIPWKL 830

  Fly  1182 ENIRGKLIGHRLKYWKTTHQEEDSVYYLSRTTRNWALIVGLQPDTYYFVKVMAYNAAGEGPESER 1246
            .|  |.|:|:.::||....:||.|...........|.:.||:.:..|:..|.|||:||.||.|..
Human   831 SN--GHLLGYEVRYWNGGGKEESSSKMKVAGNETSARLRGLKSNLAYYTAVRAYNSAGAGPFSAT 893

  Fly  1247 FEERTYRKAPQKPPSSVHVYGINPSTVRVVWRYVSPSQDEEPVEGYKVRIWESDQNMITANNT-- 1309
            ....|.:..|.:||.:| |:....:.|.:.|..|...::|..|.||||....|.||.:...||  
Human   894 VNVTTKKTPPSQPPGNV-VWNATDTKVLLNWEQVKAMENESEVTGYKVFYRTSSQNNVQVLNTNK 957

  Fly  1310 -----IVPIGQKLESYINNLTPGKSYNMRVLAYSNGGDGRMS 1346
                 ::||   .|.||          :.|.|.::||||..|
Human   958 TSAELVLPI---KEDYI----------IEVKATTDGGDGTSS 986

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ContNP_649461.2 CLECT 139..>223 CDD:214480
Ig 361..466 CDD:472250 38/104 (37%)
Ig strand B 384..388 CDD:409356 2/3 (67%)
Ig strand C 397..409 CDD:409356 2/11 (18%)
Ig strand E 428..432 CDD:409356 3/3 (100%)
Ig strand F 443..448 CDD:409356 2/4 (50%)
Ig strand G 457..460 CDD:409356 1/2 (50%)
Ig 474..559 CDD:472250 32/85 (38%)
Ig strand B 485..489 CDD:409392 0/3 (0%)
Ig strand C 499..503 CDD:409392 1/3 (33%)
Ig strand E 523..527 CDD:409392 2/3 (67%)
Ig strand F 537..542 CDD:409392 3/4 (75%)
Ig strand G 553..556 CDD:409392 1/2 (50%)
Ig_3 584..644 CDD:464046 24/61 (39%)
Ig_3 660..738 CDD:464046 22/77 (29%)
Ig 756..844 CDD:472250 29/89 (33%)
Ig strand B 775..779 CDD:409358 0/3 (0%)
Ig strand C 788..792 CDD:409358 0/3 (0%)
Ig strand E 810..814 CDD:409358 2/3 (67%)
Ig strand F 824..829 CDD:409358 3/4 (75%)
Ig strand G 837..840 CDD:409358 0/2 (0%)
Ig <868..944 CDD:472250 24/81 (30%)
Ig strand C 881..885 CDD:409359 0/3 (0%)
Ig strand E 906..910 CDD:409359 1/3 (33%)
Ig strand F 920..925 CDD:409359 2/4 (50%)
Ig strand G 933..936 CDD:409359 2/2 (100%)
FN3 944..1043 CDD:238020 37/98 (38%)
FN3 1053..1146 CDD:238020 32/95 (34%)
fn3 1156..1244 CDD:394996 28/87 (32%)
fn3 1259..1346 CDD:394996 29/93 (31%)
CNTN3NP_065923.1 Ig 25..120 CDD:472250 38/104 (37%)
Ig strand B 46..50 CDD:409353 2/3 (67%)
Ig strand C 59..63 CDD:409353 2/11 (18%)
Ig strand E 82..86 CDD:409353 3/3 (100%)
Ig strand F 97..102 CDD:409353 2/4 (50%)
Ig strand G 111..114 CDD:409353 1/2 (50%)
Ig 129..214 CDD:472250 31/84 (37%)
Ig strand B 140..144 CDD:409353 0/3 (0%)
Ig strand C 154..158 CDD:409353 1/3 (33%)
Ig strand E 179..183 CDD:409353 2/3 (67%)
Ig strand F 193..198 CDD:409353 3/4 (75%)
Ig strand G 209..212 CDD:409353 1/2 (50%)
Ig 227..315 CDD:472250 32/87 (37%)
Ig strand B 245..249 CDD:409353 1/3 (33%)
Ig strand C 258..262 CDD:409353 1/3 (33%)
Ig strand E 280..284 CDD:409353 2/3 (67%)
Ig strand F 294..299 CDD:409353 2/4 (50%)
Ig strand G 307..310 CDD:409353 0/2 (0%)
Ig 320..403 CDD:472250 26/87 (30%)
Ig strand B 335..339 CDD:143205 0/3 (0%)
Ig strand C 348..352 CDD:143205 1/3 (33%)
Ig strand E 369..373 CDD:143205 1/3 (33%)
Ig strand F 383..388 CDD:143205 3/4 (75%)
Ig strand G 396..399 CDD:143205 1/2 (50%)
Ig 408..496 CDD:472250 29/89 (33%)
Ig strand B 427..431 CDD:409353 0/3 (0%)
Ig strand C 440..444 CDD:409353 0/3 (0%)
Ig strand E 462..466 CDD:409353 2/3 (67%)
Ig strand F 476..481 CDD:409353 3/4 (75%)
Ig strand G 489..492 CDD:409353 0/2 (0%)
Ig 498..598 CDD:472250 29/103 (28%)
Ig strand B 517..521 CDD:409439 2/4 (50%)
Ig strand C 532..536 CDD:409439 0/3 (0%)
Ig strand E 560..564 CDD:409439 2/6 (33%)
Ig strand F 574..579 CDD:409439 2/4 (50%)
FN3 579..>1006 CDD:442628 143/432 (33%)
Ig strand G 587..590 CDD:409439 2/2 (100%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 684..713 13/28 (46%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.