DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cont and NCAM1

DIOPT Version :10

Sequence 1:NP_649461.2 Gene:Cont / 40553 FlyBaseID:FBgn0037240 Length:1390 Species:Drosophila melanogaster
Sequence 2:NP_001387553.1 Gene:NCAM1 / 4684 HGNCID:7656 Length:1129 Species:Homo sapiens


Alignment Length:305 Identity:62/305 - (20%)
Similarity:119/305 - (39%) Gaps:95/305 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 SSSHSDDIGSLNDALRVQQLEEEQERLNNSLFSLSSHFAQVQFRIKQMNEADPSDRLKLLSDLQK 114
            ||..|.|..|.:|:......||..:||           |::|.::|.::|     :|..||..|:
Human   486 SSDSSSDSSSDSDSSTDDSEEERAQRL-----------AELQEQLKAVHE-----QLAALSQPQQ 534

  Fly   115 FAFKGCTDMNELQRLRSESESGNDVLDKQNERQKELLKQLREQVEDLERTAYENGEGELP----- 174
                           ....:...|..:|:.|:.|:     :|:||:.:::..:    |||     
Human   535 ---------------NKPKKKEKDKKEKKKEKHKK-----KEEVEENKKSKTK----ELPPKKTK 575

  Fly   175 -----STDILKKQKAVL-------------DKLR-----EKIELNLDIDKMNQTEIQRQV----- 211
                 ::::.||:....             ||.:     ||.:|:|||:|:...::.|.|     
Human   576 KNNSSNSNVSKKEPVPTKTKPPPTYESEEEDKCKPMSYEEKRQLSLDINKLPGEKLGRVVHIIQS 640

  Fly   212 -DDALKQLVNPFKEKGQLVDQLQ--------TQITDLERFV-NFLQKENAENSNQTTPVRSMGST 266
             :.:||. .||        |:::        :.:.:|||:| :.|:|:....:.:...:  .||:
Human   641 REPSLKN-SNP--------DEIEIDFETLKPSTLRELERYVTSCLRKKRKPQAEKVDVI--AGSS 694

  Fly   267 PLSGAKSKNGSFLSGIIGCSTGRFQKNQLKNTLKGNHYG-DERAH 310
            .:.|..|......|......:...:......:.|..|.| |::.|
Human   695 KMKGFSSSESESTSESSSSDSEDSETEMAPKSKKKGHTGRDQKKH 739

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ContNP_649461.2 CLECT 139..>223 CDD:214480 26/117 (22%)
Ig 361..466 CDD:472250
Ig strand B 384..388 CDD:409356
Ig strand C 397..409 CDD:409356
Ig strand E 428..432 CDD:409356
Ig strand F 443..448 CDD:409356
Ig strand G 457..460 CDD:409356
Ig 474..559 CDD:472250
Ig strand B 485..489 CDD:409392
Ig strand C 499..503 CDD:409392
Ig strand E 523..527 CDD:409392
Ig strand F 537..542 CDD:409392
Ig strand G 553..556 CDD:409392
Ig_3 584..644 CDD:464046
Ig_3 660..738 CDD:464046
Ig 756..844 CDD:472250
Ig strand B 775..779 CDD:409358
Ig strand C 788..792 CDD:409358
Ig strand E 810..814 CDD:409358
Ig strand F 824..829 CDD:409358
Ig strand G 837..840 CDD:409358
Ig <868..944 CDD:472250
Ig strand C 881..885 CDD:409359
Ig strand E 906..910 CDD:409359
Ig strand F 920..925 CDD:409359
Ig strand G 933..936 CDD:409359
FN3 944..1043 CDD:238020
FN3 1053..1146 CDD:238020
fn3 1156..1244 CDD:394996
fn3 1259..1346 CDD:394996
NCAM1NP_001387553.1 IgI_1_NCAM-1 20..116 CDD:409451
Ig strand A 20..25 CDD:409451
Ig strand A' 28..32 CDD:409451
Ig strand B 34..44 CDD:409451
Ig strand C 50..56 CDD:409451
Ig strand C' 59..61 CDD:409451
Ig strand D 69..75 CDD:409451
Ig strand E 77..85 CDD:409451
Ig strand F 92..100 CDD:409451
Ig strand G 104..115 CDD:409451
IG_like 124..190 CDD:214653
Ig strand B 135..139 CDD:409353
Ig strand C 148..152 CDD:409353
Ig strand E 172..176 CDD:409353
Ig 211..307 CDD:472250
Ig strand B 231..235 CDD:409353
Ig strand C 244..248 CDD:409353
Ig strand E 270..274 CDD:409353
Ig strand F 284..289 CDD:409353
Ig strand G 297..300 CDD:409353
IgI_NCAM-1 306..412 CDD:143277
Ig strand A 306..311 CDD:143277
Ig strand A' 315..319 CDD:143277
Ig strand B 324..332 CDD:143277
Ig strand C 338..344 CDD:143277
Ig strand C' 347..350 CDD:143277
Ig strand D 368..374 CDD:143277
Ig strand E 377..383 CDD:143277
Ig strand F 391..399 CDD:143277
Ig strand G 402..412 CDD:143277
IG_like 421..499 CDD:214653 5/12 (42%)
Ig strand B 432..436 CDD:409353
Ig strand C 445..449 CDD:409353
Ig strand E 472..476 CDD:409353
Ig strand F 486..491 CDD:409353 2/4 (50%)
fn3 511..598 CDD:394996 22/126 (17%)
fn3 612..693 CDD:394996 20/91 (22%)
PRK12323 <913..1108 CDD:481241
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.