DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cont and robo2

DIOPT Version :10

Sequence 1:NP_649461.2 Gene:Cont / 40553 FlyBaseID:FBgn0037240 Length:1390 Species:Drosophila melanogaster
Sequence 2:NP_001259868.1 Gene:robo2 / 44522 FlyBaseID:FBgn0002543 Length:1519 Species:Drosophila melanogaster


Alignment Length:1007 Identity:229/1007 - (22%)
Similarity:369/1007 - (36%) Gaps:218/1007 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   362 PYFVKQPNDTTFDVNKNRLINDVTLSCLANGYPTPSYTWY---REVYVDDRLEYQKIDPLAQDRY 423
            |..::.|.|||  |.||   :..|.:|.|.|.|||:..|:   ||:..|          ....|.
  Fly    91 PRIIEHPMDTT--VPKN---DPFTFNCQAEGNPTPTIQWFKDGRELKTD----------TGSHRI 140

  Fly   424 TISGGNL----IIYEPKQALDQGAYHCVAENKFGRIRSESAHLNFGFIM-EFNLK------RSAE 477
            .:..|.|    :|:..::: |.|.|.|.|:|:||..||.:|.|...|:. ||.|:      ...|
  Fly   141 MLPAGGLFFLKVIHSRRES-DAGTYWCEAKNEFGVARSRNATLQVAFLRDEFRLEPANTRVAQGE 204

  Fly   478 TSEMNWGKSIFCDPPQHYPDVRYYWARDYFPNFVEEDQRVFVSRDGALYFSFIETVDRANYSCTV 542
            .:.|.      |..|:..|:.:..|.::.....:..::|:.:...|.|........|...|.|.|
  Fly   205 VALME------CGAPRGSPEPQISWRKNGQTLNLVGNKRIRIVDGGNLAIQEARQSDDGRYQCVV 263

  Fly   543 QTLVSDTGRNGPFFPLRVTPNSNYQALIFANTFPKVFPEAPVAGDEIRLECMAFGYPIPSYNWTR 607
            :.:|........|..:.|.|        |....|:  .:..|.|..:..:|...|.|:|...|.|
  Fly   264 KNVVGTRESATAFLKVHVRP--------FLIRGPQ--NQTAVVGSSVVFQCRIGGDPLPDVLWRR 318

  Fly   608 Q----GLPLQRNAYTINYGRVLIIQNATTNDNGEYSCTITNPRKTLMKSIYINIQMRPQFTIPLK 668
            .    .:||:|  ..:...|.|.:.:.|..|.|||:|...|....:..:..:.:...|:|.|..|
  Fly   319 TASGGNMPLRR--VHVLEDRSLKLDDVTLEDMGEYTCEADNAVGGITATGILTVHAPPKFVIRPK 381

  Fly   669 DMIKDYNSDVTFICEAFAIPDANYTW------------YKNAERLDPANINRDRYIIQDNVLTIK 721
            :.:.:...:|.|.|:|...|.....|            |::. |::.......|     :||:|.
  Fly   382 NQLVEIGDEVLFECQANGHPRPTLYWSVEGNSSLLLPGYRDG-RMEVTLTPEGR-----SVLSIA 440

  Fly   722 FLEKDKDDAMYQCGAQNQLKTSFSSAQLRVLSMKPSFKKHPLESEVYAVYNGNTT--------IV 778
            ...::....:..|.|.|.:.   |.:...|:|:...|:..|...|...|   |.|        :.
  Fly   441 RFAREDSGKVVTCNALNAVG---SVSSRTVVSVDTQFELPPPIIEQGPV---NQTLPVKSIVVLP 499

  Fly   779 CDPEAAPRPKFQWKKDGQVIGSGGH--RRILPSGTLTISPTSR-DDEGIYTCIASNQAGTDESHA 840
            |.....|.|:..|..||..|....|  |.:..:|.||||...| :|||:|||:|||:.| ..|.:
  Fly   500 CRTLGTPVPQVSWYLDGIPIDVQEHERRNLSDAGALTISDLQRHEDEGLYTCVASNRNG-KSSWS 563

  Fly   841 RVIVLQ-----EIRFIETP-----------PQRIVSKEHD--LIFLHCEAAFDELLDIAYVWKHN 887
            ..:.|.     .|:|...|           ||.:...|:.  |.:..........| :.||.:..
  Fly   564 GYLRLDTPTNPNIKFFRAPELSTYPGPPGKPQMVEKGENSVTLSWTRSNKVGGSSL-VGYVIEMF 627

  Fly   888 GEVLKNNHDGTGRIIVDWNRL--TVHNTSMRDAG-----DYECVVKSAVNEISSKTSVSIEGAPG 945
            |   ||..||       |..:  .|.||:....|     :|..::::     .:...:|:.....
  Fly   628 G---KNETDG-------WVAVGTRVQNTTFTQTGLLPGVNYFFLIRA-----ENSHGLSLPSPMS 677

  Fly   946 APGGVQV------IQISKTKAIIEWVDGSHNGRAIRYYN--ILGRTNWNRTWVNVS------THV 996
            .|..|..      :.:|:.:|.:      .:|..:...|  ::..|:...||..::      .:|
  Fly   678 EPITVGTRYFNSGLDLSEARASL------LSGDVVELSNASVVDSTSMKLTWQIINGKYVEGFYV 736

  Fly   997 QAREVDRYTSRQQAEVVNLTPWSAYEFSVTAVNDLGIGTPSAPSPIYSTYEDKPYIA-------P 1054
            .||::........|.|.:.|.......|.:|      ...::.|.:.||   ||.||       .
  Fly   737 YARQLPNPIVNNPAPVTSNTNPLLGSTSTSA------SASASASALIST---KPNIAAAGKRDGE 792

  Fly  1055 RNVGGGGGKIGDLTITWDPLLPQEQHSHGIHYKVFWKLKGAIEWASDEIKKQDHMGVAVVNIPLN 1119
            .|..|||..        .||        ...|::...|.|.              |.:...|...
  Fly   793 TNQSGGGAP--------TPL--------NTKYRMLTILNGG--------------GASSCTITGL 827

  Fly  1120 NYYTEYEVKVQAINSVGKGPESEIAVIHSAEDMPQVAPQKPIALAYNSTCFNVTWQPIDMSRENI 1184
            ..||.||..:.......:|..|...:..:.||:|..||....||..||:...:.|:..::  ::.
  Fly   828 VQYTLYEFFIVPFYKSVEGKPSNSRIARTLEDVPSEAPYGMEALLLNSSAVFLKWKAPEL--KDR 890

  Fly  1185 RGKLIGHRLKYWKTTHQEEDSVYYLSRTTRNWAL--------IVGLQPDTYYFVKVMAYNAAGEG 1241
            .|.|:.:.:     ..:..|:.:..||...|..:        :..|.....|.|.|.|.|.||.|
  Fly   891 HGVLLNYHV-----IVRGIDTAHNFSRILTNVTIDAASPTLVLANLTEGVMYTVGVAAGNNAGVG 950

  Fly  1242 ----PESERFEERTYRKAP----QKPPSSVHV 1265
                |.:.|.:..|.|..|    :.|.:..||
  Fly   951 PYCVPATLRLDPITKRLDPFINQRYPINQDHV 982

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ContNP_649461.2 CLECT 139..>223 CDD:214480
Ig 361..466 CDD:472250 35/110 (32%)
Ig strand B 384..388 CDD:409356 1/3 (33%)
Ig strand C 397..409 CDD:409356 4/14 (29%)
Ig strand E 428..432 CDD:409356 2/7 (29%)
Ig strand F 443..448 CDD:409356 2/4 (50%)
Ig strand G 457..460 CDD:409356 1/2 (50%)
Ig 474..559 CDD:472250 15/84 (18%)
Ig strand B 485..489 CDD:409392 0/3 (0%)
Ig strand C 499..503 CDD:409392 0/3 (0%)
Ig strand E 523..527 CDD:409392 2/3 (67%)
Ig strand F 537..542 CDD:409392 2/4 (50%)
Ig strand G 553..556 CDD:409392 0/2 (0%)
Ig_3 584..644 CDD:464046 19/63 (30%)
Ig_3 660..738 CDD:464046 18/89 (20%)
Ig 756..844 CDD:472250 32/98 (33%)
Ig strand B 775..779 CDD:409358 1/11 (9%)
Ig strand C 788..792 CDD:409358 0/3 (0%)
Ig strand E 810..814 CDD:409358 2/3 (67%)
Ig strand F 824..829 CDD:409358 3/4 (75%)
Ig strand G 837..840 CDD:409358 1/2 (50%)
Ig <868..944 CDD:472250 15/82 (18%)
Ig strand C 881..885 CDD:409359 2/3 (67%)
Ig strand E 906..910 CDD:409359 0/5 (0%)
Ig strand F 920..925 CDD:409359 1/4 (25%)
Ig strand G 933..936 CDD:409359 0/2 (0%)
FN3 944..1043 CDD:238020 18/112 (16%)
FN3 1053..1146 CDD:238020 18/99 (18%)
fn3 1156..1244 CDD:394996 23/99 (23%)
fn3 1259..1346 CDD:394996 3/7 (43%)
robo2NP_001259868.1 IgC_1_Robo 91..185 CDD:409490 35/109 (32%)
Ig strand A 91..95 CDD:409490 1/3 (33%)
Ig strand A' 98..103 CDD:409490 3/6 (50%)
Ig strand B 107..115 CDD:409490 2/7 (29%)
Ig strand C 121..126 CDD:409490 1/4 (25%)
Ig strand C' 129..131 CDD:409490 1/1 (100%)
Ig strand D 139..142 CDD:409490 1/2 (50%)
Ig strand E 145..151 CDD:409490 2/5 (40%)
Ig strand F 162..170 CDD:409490 4/7 (57%)
Ig strand G 173..185 CDD:409490 5/11 (45%)
IgI_2_Robo 192..279 CDD:409389 16/92 (17%)
Ig strand A 192..195 CDD:409389 1/2 (50%)
Ig strand A' 197..201 CDD:409389 0/3 (0%)
Ig strand B 205..212 CDD:409389 2/12 (17%)
Ig strand C 220..225 CDD:409389 1/4 (25%)
Ig strand C' 227..230 CDD:409389 0/2 (0%)
Ig strand D 237..241 CDD:409389 1/3 (33%)
Ig strand E 244..250 CDD:409389 2/5 (40%)
Ig strand F 257..265 CDD:409389 3/7 (43%)
Ig strand G 268..279 CDD:409389 1/10 (10%)
Ig 286..370 CDD:472250 21/87 (24%)
Ig strand B 300..304 CDD:409353 0/3 (0%)
Ig strand C 313..317 CDD:409353 0/3 (0%)
Ig strand E 336..340 CDD:409353 2/3 (67%)
Ig strand F 350..355 CDD:409353 3/4 (75%)
Ig strand G 363..366 CDD:409353 0/2 (0%)
Ig_3 373..457 CDD:464046 18/89 (20%)
Ig 480..566 CDD:472250 30/89 (34%)
Ig strand B 496..500 CDD:409353 0/3 (0%)
Ig strand C 509..513 CDD:409353 0/3 (0%)
Ig strand E 533..537 CDD:409353 2/3 (67%)
Ig strand F 548..553 CDD:409353 3/4 (75%)
Ig strand G 561..564 CDD:409353 1/2 (50%)
COG3979 586..>800 CDD:443178 46/244 (19%)
FN3 588..681 CDD:238020 20/108 (19%)
fn3 864..952 CDD:394996 22/94 (23%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.