DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cont and Fas2

DIOPT Version :10

Sequence 1:NP_649461.2 Gene:Cont / 40553 FlyBaseID:FBgn0037240 Length:1390 Species:Drosophila melanogaster
Sequence 2:NP_001284854.1 Gene:Fas2 / 31364 FlyBaseID:FBgn0000635 Length:885 Species:Drosophila melanogaster


Alignment Length:182 Identity:48/182 - (26%)
Similarity:72/182 - (39%) Gaps:44/182 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    69 LEEEQERLNNSLFS--LSSHFAQVQFRIKQMNEADPS--DRLKLLSDLQKF----AFKGCTDMNE 125
            ||....||......  :|.:||   .|:    |.||:  ..|.||...:.|    :.:.|:|:.|
  Fly    16 LELSSRRLRELCLKTPISGNFA---IRL----EEDPNWPSILTLLMRPRNFSSRLSVRNCSDVPE 73

  Fly   126 LQRLRSESESGNDVLDKQ----NERQKELLKQLRE----------QVED-------LERTAYENG 169
            .:|......:..|.:...    |...|.||.::.|          |:.|       |.|....|.
  Fly    74 DERSEIVGYNYKDTIQNPDVFFNGVSKRLLNRIVEFEIRCRRFTVQILDNIEKFPKLNRIIVRNA 138

  Fly   170 EGELPSTDILKKQKAVLDKLREKIELNLDIDKMNQTEIQRQVDDALKQLVNP 221
            .......|......||||:: |.:||:|  |:...|||:|     :|:|:||
  Fly   139 RNFSFELDEESGDAAVLDRI-ESLELHL--DRQWCTEIER-----MKRLINP 182

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ContNP_649461.2 CLECT 139..>223 CDD:214480 28/104 (27%)
Ig 361..466 CDD:472250
Ig strand B 384..388 CDD:409356
Ig strand C 397..409 CDD:409356
Ig strand E 428..432 CDD:409356
Ig strand F 443..448 CDD:409356
Ig strand G 457..460 CDD:409356
Ig 474..559 CDD:472250
Ig strand B 485..489 CDD:409392
Ig strand C 499..503 CDD:409392
Ig strand E 523..527 CDD:409392
Ig strand F 537..542 CDD:409392
Ig strand G 553..556 CDD:409392
Ig_3 584..644 CDD:464046
Ig_3 660..738 CDD:464046
Ig 756..844 CDD:472250
Ig strand B 775..779 CDD:409358
Ig strand C 788..792 CDD:409358
Ig strand E 810..814 CDD:409358
Ig strand F 824..829 CDD:409358
Ig strand G 837..840 CDD:409358
Ig <868..944 CDD:472250
Ig strand C 881..885 CDD:409359
Ig strand E 906..910 CDD:409359
Ig strand F 920..925 CDD:409359
Ig strand G 933..936 CDD:409359
FN3 944..1043 CDD:238020
FN3 1053..1146 CDD:238020
fn3 1156..1244 CDD:394996
fn3 1259..1346 CDD:394996
Fas2NP_001284854.1 Ig 33..121 CDD:472250 22/94 (23%)
Ig strand B 50..54 CDD:409353 2/3 (67%)
Ig strand C 66..70 CDD:409353 1/3 (33%)
Ig strand E 99..103 CDD:409353 1/3 (33%)
Ig strand F 113..118 CDD:409353 0/4 (0%)
Ig 139..209 CDD:472250 18/52 (35%)
Ig strand B 156..159 CDD:409353 1/3 (33%)
Ig strand C 168..172 CDD:409353 0/3 (0%)
Ig strand E 190..194 CDD:409353
Ig strand F 204..209 CDD:409353
IgI_4_MYLK-like 229..319 CDD:409568
Ig strand A 229..232 CDD:409568
Ig strand A' 238..241 CDD:409568
Ig strand B 246..254 CDD:409568
Ig strand C 260..264 CDD:409568
Ig strand C' 267..270 CDD:409568
Ig strand D 277..281 CDD:409568
Ig strand E 285..290 CDD:409568
Ig strand F 298..306 CDD:409568
Ig strand G 309..319 CDD:409568
IG_like 330..424 CDD:214653
Ig strand B 339..343 CDD:409353
Ig strand C 352..356 CDD:409353
Ig strand E 388..394 CDD:409353
Ig strand F 404..409 CDD:409353
Ig 447..515 CDD:409353
Ig strand B 447..451 CDD:409353
Ig strand C 460..464 CDD:409353
Ig strand E 487..491 CDD:409353
Ig strand F 501..506 CDD:409353
FN3 525..619 CDD:238020
FN3 640..735 CDD:238020
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.