DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cont and boi

DIOPT Version :10

Sequence 1:NP_649461.2 Gene:Cont / 40553 FlyBaseID:FBgn0037240 Length:1390 Species:Drosophila melanogaster
Sequence 2:NP_001096868.3 Gene:boi / 31229 FlyBaseID:FBgn0040388 Length:1105 Species:Drosophila melanogaster


Alignment Length:275 Identity:53/275 - (19%)
Similarity:96/275 - (34%) Gaps:98/275 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 EIVDGL-DFYDTMSETEWKSARLSSSHS--------------------DDIGSLNDALRVQQLEE 71
            |::.|| |..|.:...:.|..:|.:|:.                    :|...|.|.|::..|:|
  Fly   190 EVLLGLIDMEDIIPIRDIKIEKLVASYQFTKDQCDIAFCTMGKLKASIEDKTILLDNLKMMILDE 254

  Fly    72 EQERLNNSLFSLSSHFAQVQFRIKQMNEADPSDRLKLLSDLQKFAFKGCTDMNELQRLRSESESG 136
            ..:.::.:.|.     ..:.:.:.|:.|       .:|.:||...|....:.|         |.|
  Fly   255 SDKMIDIACFG-----NDIDWVLDQLQE-------DVLRNLQSCFFSASHNRN---------EDG 298

  Fly   137 NDVLDKQNERQ-------------------KELLKQLREQVEDLERTAYENGEGELPSTDILKKQ 182
            :..|..:..|.                   :.:::...::|.|:....:           |:|..
  Fly   299 SIALTSRQSRMLGENPWSLIHCPRLPGYITQRVIRIGGQRVNDIHSNPW-----------IVKMN 352

  Fly   183 KAVLDKLREKIELNLDIDKMNQTE--------------IQR--QVDDALKQLVNPFKEKGQLVDQ 231
              ::.||     |:.|:.:|..|:              :.|  ||..||:|:...||.....|.:
  Fly   353 --IICKL-----LDDDLKEMGSTKEGPWKHTIAIFCETVSRVIQVTMALRQMGYNFKPVCSSVLK 410

  Fly   232 LQTQIT--DLERFVN 244
            .|..||  ||| |.|
  Fly   411 QQQAITLNDLE-FCN 424

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ContNP_649461.2 CLECT 139..>223 CDD:214480 18/118 (15%)
Ig 361..466 CDD:472250
Ig strand B 384..388 CDD:409356
Ig strand C 397..409 CDD:409356
Ig strand E 428..432 CDD:409356
Ig strand F 443..448 CDD:409356
Ig strand G 457..460 CDD:409356
Ig 474..559 CDD:472250
Ig strand B 485..489 CDD:409392
Ig strand C 499..503 CDD:409392
Ig strand E 523..527 CDD:409392
Ig strand F 537..542 CDD:409392
Ig strand G 553..556 CDD:409392
Ig_3 584..644 CDD:464046
Ig_3 660..738 CDD:464046
Ig 756..844 CDD:472250
Ig strand B 775..779 CDD:409358
Ig strand C 788..792 CDD:409358
Ig strand E 810..814 CDD:409358
Ig strand F 824..829 CDD:409358
Ig strand G 837..840 CDD:409358
Ig <868..944 CDD:472250
Ig strand C 881..885 CDD:409359
Ig strand E 906..910 CDD:409359
Ig strand F 920..925 CDD:409359
Ig strand G 933..936 CDD:409359
FN3 944..1043 CDD:238020
FN3 1053..1146 CDD:238020
fn3 1156..1244 CDD:394996
fn3 1259..1346 CDD:394996
boiNP_001096868.3 IG_like 42..131 CDD:214653
Ig 161..221 CDD:409353 8/30 (27%)
Ig strand B 161..165 CDD:409353
Ig strand C 175..179 CDD:409353
Ig strand E 196..200 CDD:409353 1/3 (33%)
Ig strand F 210..215 CDD:409353 1/4 (25%)
Ig 242..315 CDD:472250 17/93 (18%)
Ig strand B 260..264 CDD:409353 0/3 (0%)
Ig strand C 273..277 CDD:409353 1/3 (33%)
Ig strand E 294..298 CDD:409353 2/12 (17%)
Ig strand F 308..313 CDD:409353 1/4 (25%)
Ig <352..408 CDD:472250 14/62 (23%)
Ig strand C 363..367 CDD:409353 1/3 (33%)
Ig strand E 384..388 CDD:409353 1/3 (33%)
Ig strand F 398..403 CDD:409353 1/4 (25%)
FN3 <448..>700 CDD:442628
FN3 613..700 CDD:238020
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.