DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cont and Myot

DIOPT Version :10

Sequence 1:NP_649461.2 Gene:Cont / 40553 FlyBaseID:FBgn0037240 Length:1390 Species:Drosophila melanogaster
Sequence 2:NP_001424334.1 Gene:Myot / 291605 RGDID:1310569 Length:497 Species:Rattus norvegicus


Alignment Length:331 Identity:63/331 - (19%)
Similarity:102/331 - (30%) Gaps:120/331 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly   351 DINDMERIPR---GPYFVKQPNDTTFDVNKNRLINDVTLSCLANGYPTPSYTWYREVYVDDRLEY 412
            |.||.:.|..   .|.|::.|.:  ..:.:.|...   :....:|.|.|..:|    |::.||  
  Rat   235 DANDQDAIQEKFYPPRFIQVPEN--MSIEEGRFCR---MDFKVSGLPAPDVSW----YLNGRL-- 288

  Fly   413 QKIDPLAQDRYTISGGNLIIYEPKQALDQGAYHCVAENKFGRIRSESAHLNFGFIMEFNLKRSAE 477
            .:.|.|.:...:..|.:.:|:|..:|.|.|.|.|||.|:.|                        
  Rat   289 VQSDELHKMIVSEKGFHSLIFEVVRASDAGPYACVARNRAG------------------------ 329

  Fly   478 TSEMNWGKSIFCDPPQHYPDVRYYWARDYFPNFVEEDQRVFVSRDGALYFSFIETVDRANYSCTV 542
                                                                     .|.::..:
  Rat   330 ---------------------------------------------------------EATFTVQL 337

  Fly   543 QTLVSDTGRNGPFFPLRVTPNSNYQALIFANTFPKVFPEAPVAGDEIRLECMAFGYPIPSYNWTR 607
            ..|..:..| .|.|             |:.....|||     .|:.::|||.....|.|...|.|
  Rat   338 DVLAKEHKR-APMF-------------IYKPQSKKVF-----EGESVKLECQISAIPPPKLFWKR 383

  Fly   608 QGLPLQRNA-----YTINYGRV-LIIQNATTNDNGEYSCTITNPRKTLMKSIYINIQMRPQFTIP 666
            ....:|.|.     |..|.||| |:|::....|.|.|:.:..|.......:..:::..||..|.|
  Rat   384 NNEMVQFNTDRISLYHDNAGRVTLLIKDVNKKDAGWYTVSAVNEAGVTTCNTRLDVTARPNQTPP 448

  Fly   667 LKDMIK 672
            ....::
  Rat   449 APKQLR 454

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ContNP_649461.2 CLECT 139..>223 CDD:214480
Ig 361..466 CDD:472250 25/104 (24%)
Ig strand B 384..388 CDD:409356 0/3 (0%)
Ig strand C 397..409 CDD:409356 2/11 (18%)
Ig strand E 428..432 CDD:409356 0/3 (0%)
Ig strand F 443..448 CDD:409356 2/4 (50%)
Ig strand G 457..460 CDD:409356 0/2 (0%)
Ig 474..559 CDD:472250 5/84 (6%)
Ig strand B 485..489 CDD:409392 0/3 (0%)
Ig strand C 499..503 CDD:409392 0/3 (0%)
Ig strand E 523..527 CDD:409392 0/3 (0%)
Ig strand F 537..542 CDD:409392 0/4 (0%)
Ig strand G 553..556 CDD:409392 1/2 (50%)
Ig_3 584..644 CDD:464046 20/65 (31%)
Ig_3 660..738 CDD:464046 4/13 (31%)
Ig 756..844 CDD:472250
Ig strand B 775..779 CDD:409358
Ig strand C 788..792 CDD:409358
Ig strand E 810..814 CDD:409358
Ig strand F 824..829 CDD:409358
Ig strand G 837..840 CDD:409358
Ig <868..944 CDD:472250
Ig strand C 881..885 CDD:409359
Ig strand E 906..910 CDD:409359
Ig strand F 920..925 CDD:409359
Ig strand G 933..936 CDD:409359
FN3 944..1043 CDD:238020
FN3 1053..1146 CDD:238020
fn3 1156..1244 CDD:394996
fn3 1259..1346 CDD:394996
MyotNP_001424334.1 None
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.