DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment Cont and oig-5

DIOPT Version :9

Sequence 1:	NP_649461.2	Gene:	Cont / 40553	FlyBaseID:	FBgn0037240	Length:	1390	Species:	Drosophila melanogaster
Sequence 2:	NP_001023534.1	Gene:	oig-5 / 259604	WormBaseID:	WBGene00023520	Length:	164	Species:	Caenorhabditis elegans

Alignment Length:	126	Identity:	31/126 - (24%)
Similarity:	51/126 - (40%)	Gaps:	7/126 - (5%)

- Green bases have known domain annotations that are detailed below.

  Fly   518 FVSRDGALYFSFIETVDRANYSCTVQTLVSDTGRNGPFFPLRVTPNSNYQALIFANTFPKVFPEA 582
            |:...|.|.|    .|....|:||.:.:.....::|..|.|::|.|..........|...:...:
Worm    21 FIFLLGCLLF----LVSDRYYTCTAENIRLKDYKSGNQFSLQITNNKRRSLQQTTPTEQYLNRSS 81

  Fly   583 PVA--GDEIRLECMAFGYPIPSYNWTRQGLPLQRN-AYTINYGRVLIIQNATTNDNGEYSC 640
            |:|  |:..:|.|....||:|...|...|..:..: .|........::.|||.:..|:|.|
Worm    82 PIAEQGNLHKLHCFFSAYPVPIPRWFHNGSEINEDKGYRFESNGNTLVFNATQDKAGKYDC 142

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
Cont	NP_649461.2	CLECT	139..>223	CDD:214480
		Ig	361..460	CDD:299845
		I-set	362..462	CDD:254352
		Ig	466..559	CDD:299845	10/40 (25%)
		IG_like	584..657	CDD:214653	16/60 (27%)
		IGc2	586..645	CDD:197706	15/56 (27%)
		Ig	667..751	CDD:299845
		IG_like	676..751	CDD:214653
		IG_like	765..844	CDD:214653
		Ig	773..844	CDD:299845
		I-set	851..940	CDD:254352
		Ig	866..944	CDD:299845
		FN3	944..1043	CDD:238020
		FN3	1053..1146	CDD:238020
		fn3	1156..1244	CDD:278470
		fn3	1259..1346	CDD:278470
oig-5	NP_001023534.1	Ig	87..143	CDD:386229	15/56 (27%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_KOG3513
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	0.900