DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cont and Bsg

DIOPT Version :10

Sequence 1:NP_649461.2 Gene:Cont / 40553 FlyBaseID:FBgn0037240 Length:1390 Species:Drosophila melanogaster
Sequence 2:NP_001103352.1 Gene:Bsg / 25246 RGDID:2220 Length:388 Species:Rattus norvegicus


Alignment Length:382 Identity:85/382 - (22%)
Similarity:139/382 - (36%) Gaps:102/382 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   758 FKKHPLESEVYAVYNGNTTIVCDPEAAPRPKFQWKKDGQVIGSG------GHR----------RI 806
            |.|.|:..|.:|  .|:..:.|:...:|.|:.||..:|......      |.|          |.
  Rat    25 FLKAPMSQEQWA--GGSVVLHCEAVGSPMPEIQWWFEGNEPNDSCSQLWDGARLDRVHIHATYRQ 87

  Fly   807 LPSGTLTISPTSRDDEGIYTCIASNQAGTDESH-------------ARVIVLQEIRFIETPPQRI 858
            ..:.||::...:.:|.|.|.|.||:.  .|.:|             |.|:|| |...|.|..|.:
  Rat    88 HAASTLSVDGLAAEDTGTYECRASSD--PDRNHLTRPPRVKWVRAQASVVVL-EPGTIVTSVQEV 149

  Fly   859 VSKEHDLIFLHCEAAFDELLDI-AYVWKHNGEVLKNNHDGTGRIIVDWNRLTVHNTSMR---DA- 918
            .||.....||:...     :|| .:.|...|:||:.:              |:.:..|:   || 
  Rat   150 DSKTQLTCFLNSSG-----IDIVGHRWMRGGKVLQED--------------TLPDLQMKYTVDAD 195

  Fly   919 ---GDYECVVKSAVNEISSKTSVSIEGAP---------GAPGGVQVIQISKTKA----IIEWV-- 965
               |:|.|:.   :.|...:.::::||.|         .|..|..|..|.|::|    :.|||  
  Rat   196 DRSGEYSCIF---LPEPVGRGNINVEGPPRIKVGKKSEHASEGEFVKLICKSEASHPPVDEWVWF 257

  Fly   966 ----DG----SHNGRAIRYYNILGRTNWNR-------------TWVNVSTHVQAREVDRYTSRQQ 1009
                .|    |:...|...|.|:.....:.             |:|..:|:.|....:..:.|.:
  Rat   258 KTSDTGDQTISNGTEANSKYVIISTPELSELIISDLDMNVDPGTYVCNATNSQGSARETISLRVR 322

  Fly  1010 AEVVNLTPWSAYEFSVTAVNDLGIGTPSAPSPIYSTYEDKPYIAPRNVGGGGGKIGD 1066
            :.:..|.|:......|..:..:.........|..:..||.|..||  :.|.|..:.|
  Rat   323 SRLAALWPFLGIVAEVLVLVTIIFIYEKRRKPDQTLDEDDPGAAP--LKGSGSHLND 377

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ContNP_649461.2 CLECT 139..>223 CDD:214480
Ig 361..466 CDD:472250
Ig strand B 384..388 CDD:409356
Ig strand C 397..409 CDD:409356
Ig strand E 428..432 CDD:409356
Ig strand F 443..448 CDD:409356
Ig strand G 457..460 CDD:409356
Ig 474..559 CDD:472250
Ig strand B 485..489 CDD:409392
Ig strand C 499..503 CDD:409392
Ig strand E 523..527 CDD:409392
Ig strand F 537..542 CDD:409392
Ig strand G 553..556 CDD:409392
Ig_3 584..644 CDD:464046
Ig_3 660..738 CDD:464046
Ig 756..844 CDD:472250 27/114 (24%)
Ig strand B 775..779 CDD:409358 0/3 (0%)
Ig strand C 788..792 CDD:409358 1/3 (33%)
Ig strand E 810..814 CDD:409358 2/3 (67%)
Ig strand F 824..829 CDD:409358 2/4 (50%)
Ig strand G 837..840 CDD:409358 1/15 (7%)
Ig <868..944 CDD:472250 17/83 (20%)
Ig strand C 881..885 CDD:409359 0/3 (0%)
Ig strand E 906..910 CDD:409359 0/3 (0%)
Ig strand F 920..925 CDD:409359 2/4 (50%)
Ig strand G 933..936 CDD:409359 0/2 (0%)
FN3 944..1043 CDD:238020 24/134 (18%)
FN3 1053..1146 CDD:238020 5/14 (36%)
fn3 1156..1244 CDD:394996
fn3 1259..1346 CDD:394996
BsgNP_001103352.1 Ig 23..138 CDD:472250 29/117 (25%)
Ig strand B 40..44 CDD:409353 0/3 (0%)
Ig strand C 53..57 CDD:409353 1/3 (33%)
Ig strand E 91..95 CDD:409353 2/3 (67%)
Ig strand F 105..110 CDD:409353 2/4 (50%)
Ig strand G 129..132 CDD:409353 0/2 (0%)
IG_like 228..321 CDD:214653 18/92 (20%)
Ig strand C 253..257 CDD:409353 3/3 (100%)
Ig strand E 270..290 CDD:409353 3/19 (16%)
Ig strand F 301..306 CDD:409353 2/4 (50%)
Ig strand G 314..317 CDD:409353 0/2 (0%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 355..388 8/25 (32%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.