DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cont and Cntn2

DIOPT Version :10

Sequence 1:NP_649461.2 Gene:Cont / 40553 FlyBaseID:FBgn0037240 Length:1390 Species:Drosophila melanogaster
Sequence 2:NP_796103.2 Gene:Cntn2 / 21367 MGIID:104518 Length:1040 Species:Mus musculus


Alignment Length:1036 Identity:318/1036 - (30%)
Similarity:495/1036 - (47%) Gaps:96/1036 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   361 GPYFVKQPNDTTFDVNKNRLINDVTLSCLANGYPTPSYTWYREVYVDDRLEYQKIDPLAQDRYTI 425
            ||.|.:||....|.  :....:.|||:|.|...|..:|.|        ::...:::.....|:.:
Mouse    38 GPVFEEQPVGLLFP--EESAEDQVTLACRARASPPATYRW--------KMNGTEMNLEPGSRHQL 92

  Fly   426 SGGNLIIYEPKQALDQGAYHCVAENKFGRIRSESAHLNFGFIMEFNL-KRSAETSEMNWGKSIFC 489
            .||||:|..|.:|.|.|.|.|:|.|..|.:.|:.|.|.|||:.||:. :|....:...||..:.|
Mouse    93 MGGNLVIMSPTKAQDAGVYQCLASNPVGTVVSKEAVLRFGFLQEFSKEERDPVKTHEGWGVMLPC 157

  Fly   490 DPPQHYPDVRYYWARDYFPNFVEEDQRVFVSR-DGALYFSFIETVDRANYSCTVQTLVSDTGRNG 553
            :||.|||.:.|.|..:.||||:..|.|.|||: .|.||.:.....|..|||| :.|...|.....
Mouse   158 NPPAHYPGLSYRWLLNEFPNFIPTDGRHFVSQTTGNLYIARTNASDLGNYSC-LATSHLDFSTKS 221

  Fly   554 PFFPLRVTPNSNYQALIFANTFPKVF---------PEA-PVAGDEIRLECMAFGYPIPSYNWTRQ 608
            .|        |.:..|..|...|::|         ||. .:.|.::.|||.|||.|:|...|.:.
Mouse   222 VF--------SKFAQLNLAAEDPRLFAPSIKARFPPETYALVGQQVTLECFAFGNPVPRIKWRKV 278

  Fly   609 GLPLQRNAYTINYGRVLIIQNATTNDNGEYSCTITNP--RKTLMKSIYINIQMRPQFTIPLKDMI 671
            ...|.....|..  ..|.|.:.:..|.|.|.|...|.  |.|:...|.  :|.:|::...:.|..
Mouse   279 DGSLSPQWGTAE--PTLQIPSVSFEDEGTYECEAENSKGRDTVQGRII--VQAQPEWLKVISDTE 339

  Fly   672 KDYNSDVTFICEAFAIPDANYTWYKNAERLDPANINRDRYIIQDNVLTIKFLEKD-KDDAMYQCG 735
            .|..|::.:.|.|...|.....|.:|.|.|  |:.||...:..|    ::|.:.: :|..||||.
Mouse   340 ADIGSNLRWGCAAAGKPRPMVRWLRNGEPL--ASQNRVEVLAGD----LRFSKLNLEDSGMYQCV 398

  Fly   736 AQNQLKTSFSSAQLRVLSMKPSFKKHPLESEVYAVYNGNTTIVCDPEAAPRPKFQWKKDGQVIGS 800
            |:|:..|.::||:|.|.::.|.|:::|:...:.|...|..:|.|.|.|||:....|.|..:::|:
Mouse   399 AENKHGTIYASAELAVQALAPDFRQNPVRRLIPAARGGEISIPCQPRAAPKATILWSKGTEILGN 463

  Fly   801 GGHRRILPSGTLTISPTSRDDEGIYTCIASNQAGTDESHARVIVLQEIRFIETPPQRIVSKEHDL 865
            .....:...|||.|...||.|||.|||.|.|..|...| ..::.:::...|...|........|.
Mouse   464 STRVTVTLDGTLIIRNISRSDEGKYTCFAENFMGKANS-TGILSVRDATKITLAPSSADINVGDN 527

  Fly   866 IFLHCEAAFDELLDIAYVW----------KHNGEVLKNNHDGTGRIIVDWNRLTVHNTSMRDAGD 920
            :.|.|.|:.|..:|:.:.|          |..|...:.:...|   |.|   ||:.|..:|..|.
Mouse   528 LTLQCHASHDPTMDLTFTWTLDDFPVDFDKPGGHYRRASVKET---IGD---LTILNAQLRHGGT 586

  Fly   921 YECVVKSAVNEISSKTSVSIEGAPGAPGGVQVIQISKTKAIIEWVDGSHNGRAIRYYNILGRTNW 985
            |.|:.::.|:..|.:.:|.:.|.||.||||.|..|..|...:.|..|..|...|..|.:..||..
Mouse   587 YTCMAQTVVDGASKEATVLVRGPPGPPGGVVVRDIGDTTVQLSWSRGFDNHSPIAKYTLQARTPP 651

  Fly   986 NRTWVNVSTHVQAREVDRYTSRQQAEVVNLTPWSAYEFSVTAVNDLGIGTPSAPSPIYSTYEDKP 1050
            :..|..|.|:    .|:...:.:.|:|:.|.||..|||.|:|.|.||.|.||.||....|.|..|
Mouse   652 SGKWKQVRTN----PVNIEGNAETAQVLGLMPWMDYEFRVSASNILGTGEPSGPSSRIRTKEAVP 712

  Fly  1051 YIAPRNVGGGGGKIGDLTITWDPLLPQEQHSHGIHYKVFWKLKGAIEWASDEIKKQDHMGVAVVN 1115
            .:||..:.||||..|:|||.|.|:..:.|:..|..|.:.::.:|:..|.:..:...|.......|
Mouse   713 SVAPSGLSGGGGAPGELTINWTPMSREYQNGDGFGYLLSFRRQGSSSWQTARVPGADTQYFVYSN 777

  Fly  1116 IPLNNYYTEYEVKVQAINSVGKGPESEIAVIHSAEDMPQVAPQKPIALAYNSTCFNVTWQPIDMS 1180
            ..::. ||.:|||:::.|..|.||||..|:::|||:.|:|||.|..|...:|:..||:|:|:   
Mouse   778 DSIHP-YTPFEVKIRSYNRRGDGPESLTAIVYSAEEEPKVAPAKVWAKGSSSSEMNVSWEPV--- 838

  Fly  1181 RENIRGKLIGHRLKYWKTTHQEEDSVYYLSRTTRNWALIVGLQPDTYYFVKVMAYNAAGEGPESE 1245
            .:::.|.|:|:.::|||...:|..:....:....:.|.:.||.|:|.|.|.|.|||.||.||.|.
Mouse   839 LQDMNGILLGYEIRYWKAGDKEAAADRVRTAGLDSSARVTGLYPNTKYHVTVRAYNRAGTGPASP 903

  Fly  1246 RFEERTYRKAPQKPPSSVHVYGINPSTVRVVWRYVSPSQDEEPVEGYKVRIWESDQN-----MIT 1305
            ..:..|.:..|::||.::. :..:.|::.:.|..|.|.::|..|.|||: ::::|..     .:|
Mouse   904 SADAMTMKPPPRRPPGNIS-WTFSSSSLSLKWDPVVPLRNESTVTGYKM-LYQNDLQPTPMLHLT 966

  Fly  1306 ANNTI-VPIGQKL-ESYINNLTPGKSYNMRVLAYSNGGDGRMSSPTLHFQMGKTTRNGANT 1364
            :.|.| :|:.:.: .:.:...|.|.           ||||..:.  :|.     .|||..:
Mouse   967 SKNWIEIPVPEDIGHALVQIRTTGP-----------GGDGIPAE--VHI-----VRNGGTS 1009

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ContNP_649461.2 CLECT 139..>223 CDD:214480
Ig 361..466 CDD:472250 33/104 (32%)
Ig strand B 384..388 CDD:409356 3/3 (100%)
Ig strand C 397..409 CDD:409356 2/11 (18%)
Ig strand E 428..432 CDD:409356 3/3 (100%)
Ig strand F 443..448 CDD:409356 2/4 (50%)
Ig strand G 457..460 CDD:409356 1/2 (50%)
Ig 474..559 CDD:472250 31/85 (36%)
Ig strand B 485..489 CDD:409392 0/3 (0%)
Ig strand C 499..503 CDD:409392 1/3 (33%)
Ig strand E 523..527 CDD:409392 2/3 (67%)
Ig strand F 537..542 CDD:409392 4/4 (100%)
Ig strand G 553..556 CDD:409392 0/2 (0%)
Ig_3 584..644 CDD:464046 18/59 (31%)
Ig_3 660..738 CDD:464046 22/78 (28%)
Ig 756..844 CDD:472250 30/87 (34%)
Ig strand B 775..779 CDD:409358 1/3 (33%)
Ig strand C 788..792 CDD:409358 0/3 (0%)
Ig strand E 810..814 CDD:409358 3/3 (100%)
Ig strand F 824..829 CDD:409358 3/4 (75%)
Ig strand G 837..840 CDD:409358 1/2 (50%)
Ig <868..944 CDD:472250 22/85 (26%)
Ig strand C 881..885 CDD:409359 1/13 (8%)
Ig strand E 906..910 CDD:409359 1/3 (33%)
Ig strand F 920..925 CDD:409359 2/4 (50%)
Ig strand G 933..936 CDD:409359 1/2 (50%)
FN3 944..1043 CDD:238020 38/98 (39%)
FN3 1053..1146 CDD:238020 31/92 (34%)
fn3 1156..1244 CDD:394996 31/87 (36%)
fn3 1259..1346 CDD:394996 22/93 (24%)
Cntn2NP_796103.2 Ig 37..133 CDD:472250 33/104 (32%)
Ig strand B 59..63 CDD:409437 3/3 (100%)
Ig strand C 72..76 CDD:409437 2/11 (18%)
Ig strand E 95..99 CDD:409437 3/3 (100%)
Ig strand F 110..115 CDD:409437 2/4 (50%)
Ig strand G 124..127 CDD:409437 1/2 (50%)
Ig2_Contactin-2-like 141..230 CDD:409392 32/97 (33%)
Ig strand A 143..148 CDD:409392 0/4 (0%)
Ig strand B 152..158 CDD:409392 1/5 (20%)
Ig strand C 166..172 CDD:409392 2/5 (40%)
Ig strand C' 177..179 CDD:409392 1/1 (100%)
Ig strand D 184..189 CDD:409392 3/4 (75%)
Ig strand E 192..196 CDD:409392 2/3 (67%)
Ig strand F 206..214 CDD:409392 5/8 (63%)
Ig strand G 218..230 CDD:409392 2/19 (11%)
Ig 241..326 CDD:472250 24/88 (27%)
Ig strand B 259..263 CDD:409357 1/3 (33%)
Ig strand C 272..276 CDD:409357 0/3 (0%)
Ig strand E 291..295 CDD:409357 1/3 (33%)
Ig strand F 305..310 CDD:409357 2/4 (50%)
Ig strand G 318..321 CDD:409357 1/2 (50%)
Ig4_Contactin-2-like 330..414 CDD:143205 26/89 (29%)
Ig strand A 330..333 CDD:143205 0/2 (0%)
Ig strand A' 337..341 CDD:143205 1/3 (33%)
Ig strand B 345..353 CDD:143205 1/7 (14%)
Ig strand C 359..364 CDD:143205 1/4 (25%)
Ig strand C' 366..369 CDD:143205 1/2 (50%)
Ig strand D 374..378 CDD:143205 1/3 (33%)
Ig strand E 380..385 CDD:143205 1/8 (13%)
Ig strand F 394..401 CDD:143205 5/6 (83%)
Ig strand G 405..414 CDD:143205 4/8 (50%)
Ig5_Contactin 419..507 CDD:409358 30/88 (34%)
Ig strand A 419..424 CDD:409358 2/4 (50%)
Ig strand A' 427..432 CDD:409358 0/4 (0%)
Ig strand B 436..443 CDD:409358 2/6 (33%)
Ig strand C 451..455 CDD:409358 0/3 (0%)
Ig strand D 469..472 CDD:409358 0/2 (0%)
Ig strand E 473..478 CDD:409358 3/4 (75%)
Ig strand F 486..494 CDD:409358 5/7 (71%)
Ig strand G 500..507 CDD:409358 1/7 (14%)
Ig 509..605 CDD:472250 23/101 (23%)
Ig strand B 528..532 CDD:409440 1/3 (33%)
Ig strand C 543..547 CDD:409440 0/3 (0%)
Ig strand E 572..576 CDD:409440 2/6 (33%)
Ig strand F 586..591 CDD:409440 2/4 (50%)
Ig strand G 599..602 CDD:409440 1/2 (50%)
FN3 620..707 CDD:238020 31/90 (34%)
FN3 728..808 CDD:238020 24/80 (30%)
Cell attachment site. /evidence=ECO:0000255 796..798 0/1 (0%)
FN3 817..909 CDD:238020 32/94 (34%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 897..922 8/24 (33%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.