DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cont and DSCAM

DIOPT Version :10

Sequence 1:NP_649461.2 Gene:Cont / 40553 FlyBaseID:FBgn0037240 Length:1390 Species:Drosophila melanogaster
Sequence 2:NP_001380.2 Gene:DSCAM / 1826 HGNCID:3039 Length:2012 Species:Homo sapiens


Alignment Length:1331 Identity:276/1331 - (20%)
Similarity:455/1331 - (34%) Gaps:377/1331 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   241 LHDNRFLVQNDLNNQNINNPNQFYNSL---PGTVNQRNQNNLRGFIGPNQ---PYGDNRYV---- 295
            :|||.:....:..:..|.:.:....::   |.||...:|..:||.:...:   |.....|:    
Human    95 IHDNTYYCTAENPSGKIRSQDVHIKAVLREPYTVRVEDQKTMRGNVAVFKCIIPSSVEAYITVVS 159

  Fly   296 --RDRVVYAFSKKRDRWMFMPAYEIELNLFICESKVLYSSDNVNIKLDDKRPYHYGLDINDMERI 358
              :|.|......:               ..|..:..||..|..|    :...|:|       ..|
Human   160 WEKDTVSLVSGSR---------------FLITSTGALYIKDVQN----EDGLYNY-------RCI 198

  Fly   359 PRGPY------------FVKQPNDTT------FDVNKNRLINDVTLSCLANGYPTPSYTWYRE-- 403
            .|..|            ||..|.::.      ||..|......|.|.|.|.|:|.|.|.|.::  
Human   199 TRHRYTGETRQSNSARLFVSDPANSAPSILDGFDHRKAMAGQRVELPCKALGHPEPDYRWLKDNM 263

  Fly   404 -VYVDDRLEYQKIDPLAQDRYTISGGNLIIYEPKQALDQGAYHCVAENKFG-------------- 453
             :.:..|  :||         |::|   ::.|..:..|.|:|.|...|::|              
Human   264 PLELSGR--FQK---------TVTG---LLIENIRPSDSGSYVCEVSNRYGTAKVIGRLYVKQPL 314

  Fly   454 --RIRSESAHLNFGFIMEFNLK-RSAETSEMNW---------GKSIFCDPPQHYPDVRYYWARDY 506
              .|.......:.|..:..:.. ...|..|::|         ||::......|            
Human   315 KATISPRKVKSSVGSQVSLSCSVTGTEDQELSWYRNGEILNPGKNVRITGINH------------ 367

  Fly   507 FPNFVEEDQRVFVSRDGALYFSFIETVDRANYSCTVQTLVSDTGRNGPFFPLRVTPNSNYQALIF 571
             .|.:.:.   .|..||..|..|:.. |:.:....||.::.|.           ||.     :|.
Human   368 -ENLIMDH---MVKSDGGAYQCFVRK-DKLSAQDYVQVVLEDG-----------TPK-----IIS 411

  Fly   572 ANTFPKVFPEAPVAGDEIRLECMAFGYPIPSYNWTRQGLP-LQRNAYTINY-----GRV---LII 627
            |.:...|.|..||:     |.|...|.|:|:..||....| |:..::.|:.     |.|   |.|
Human   412 AFSEKVVSPAEPVS-----LMCNVKGTPLPTITWTLDDDPILKGGSHRISQMITSEGNVVSYLNI 471

  Fly   628 QNATTNDNGEYSCTITNPRKTLMKSIYINIQMRPQFTIPLKDMIKDYNSDVTFICEAFAIPDANY 692
            .::...|.|.|.||..|....::....||:: .|....|:|::......|....|.....|..:.
Human   472 SSSQVRDGGVYRCTANNSAGVVLYQARINVR-GPASIRPMKNITAIAGRDTYIHCRVIGYPYYSI 535

  Fly   693 TWYKNAERLDPANINRDRYIIQDNVLTIKF--LEKDKDDAMYQCG--AQNQLKTS---------- 743
            .||||:..| |.|   .|.:..:|..|:|.  ::|:.|:..|.|.  .|.||.||          
Human   536 KWYKNSNLL-PFN---HRQVAFENNGTLKLSDVQKEVDEGEYTCNVLVQPQLSTSQSVHVTVKVP 596

  Fly   744 ----------FSSAQ------------------------------------------LRVLSMK- 755
                      ||..|                                          ||:.::. 
Human   597 PFIQPFEFPRFSIGQRVFIPCVVVSGDLPITITWQKDGRPIPGSLGVTIDNIDFTSSLRISNLSL 661

  Fly   756 ----------------------------PSFKKHPLESEVYAVYNGNTTIVCDPEAAPRPKFQWK 792
                                        |.|...|.:.:  .:|.....:.|..|..|.|...||
Human   662 MHNGNYTCIARNEAAAVEHQSQLIVRVPPKFVVQPRDQD--GIYGKAVILNCSAEGYPVPTIVWK 724

  Fly   793 -------KDGQVIGSGGHRRILPSGTLTISPTSRDDEGIYTCIASNQAGTDESHARVIVLQEIRF 850
                   ...|.|...|..::|.:|:|.|.....:|.|.|.|..||..|.|.|.:..:.::....
Human   725 FSKGAGVPQFQPIALNGRIQVLSNGSLLIKHVVEEDSGYYLCKVSNDVGADVSKSMYLTVKIPAM 789

  Fly   851 IETPPQRIVSKEHDLIFLHCEAAFDELLDIAYVWKHNGEVLKNNHDGTGRIIVDW--------NR 907
            |.:.|...::.:.....:.|.|..::  .|...|:....::   :....|.:|..        :.
Human   790 ITSYPNTTLATQGQKKEMSCTAHGEK--PIIVRWEKEDRII---NPEMARYLVSTKEVGEEVIST 849

  Fly   908 LTVHNTSMRDAGDYECVVKSAVNEISSKTSVSIEGAPGAPGGVQVIQISKTKA---IIEWVDGSH 969
            |.:..|...|:|.:.|...::..|......::::..|..|    .|:|...||   .:.|..|..
Human   850 LQILPTVREDSGFFSCHAINSYGEDRGIIQLTVQEPPDPP----EIEIKDVKARTITLRWTMGFD 910

  Fly   970 NGRAIRYYNILGRTNWNRTWVNVSTHVQAREVDRYTSRQQAEVVNLTPWSAYEFSVTAVNDLGIG 1034
            ....|..|:|..: |.:.:|.:..     |..|.......|.::::.|.|.|...:.|.|.:|..
Human   911 GNSPITGYDIECK-NKSDSWDSAQ-----RTKDVSPQLNSATIIDIHPSSTYSIRMYAKNRIGKS 969

  Fly  1035 TPSAPSPIYSTYEDKPYIAPRNVGGGGGKIGDLTITWDPLL----PQEQHSHGI---HYKVFWK- 1091
            .||                           .:||||.|...    |||.|...|   ..:|.|| 
Human   970 EPS---------------------------NELTITADEAAPDGPPQEVHLEPISSQSIRVTWKA 1007

  Fly  1092 ---------LKG-------------------AIEWASD-EIKKQDHMGVAVVNIPLNNYYTEYEV 1127
                     ::|                   :::.:.| |:...|::          |.:|:|.:
Human  1008 PKKHLQNGIIRGYQIGYREYSTGGNFQFNIISVDTSGDSEVYTLDNL----------NKFTQYGL 1062

  Fly  1128 KVQAINSVGKGPESEIAVIHSAEDMPQVAPQKPIALAYNSTCFNVTWQPIDMSRENIRGKLIGHR 1192
            .|||.|..|.||.|:..:..:.||:|...|:...|:|.:....:::|.  .:|:|.:.|.|.|.|
Human  1063 VVQACNRAGTGPSSQEIITTTLEDVPSYPPENVQAIATSPESISISWS--TLSKEALNGILQGFR 1125

  Fly  1193 LKYWKTTHQEEDSVYYLSRTTRNWALIVGLQPDTYYFVKVMAYNAAGEGPESERFEERTYRKAPQ 1257
            :.||......|........||:....:.||:..|.|.::|:|:..||:|..||:...||....| 
Human  1126 VIYWANLMDGELGEIKNITTTQPSLELDGLEKYTNYSIQVLAFTRAGDGVRSEQIFTRTKEDVP- 1189

  Fly  1258 KPPSSVHVYGINPSTVRVVWRYVSPSQDEEPVEGYKVRIWESDQNMITANNTIVPIGQKLE---- 1318
            .||:.|.....:.|.|.|.|  :.|.:....:..|.|          ..::....:..:.|    
Human  1190 GPPAGVKAAAASASMVFVSW--LPPLKLNGIIRKYTV----------FCSHPYPTVISEFEASPD 1242

  Fly  1319 --SY-INNLTPGKSYNMRVLAYSNGGDGRMS 1346
              || |.||:..:.|::.|:|.::.|.|..|
Human  1243 SFSYRIPNLSRNRQYSVWVVAVTSAGRGNSS 1273

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ContNP_649461.2 CLECT 139..>223 CDD:214480
Ig 361..466 CDD:472250 29/141 (21%)
Ig strand B 384..388 CDD:409356 2/3 (67%)
Ig strand C 397..409 CDD:409356 2/14 (14%)
Ig strand E 428..432 CDD:409356 0/3 (0%)
Ig strand F 443..448 CDD:409356 2/4 (50%)
Ig strand G 457..460 CDD:409356 0/2 (0%)
Ig 474..559 CDD:472250 16/93 (17%)
Ig strand B 485..489 CDD:409392 1/3 (33%)
Ig strand C 499..503 CDD:409392 0/3 (0%)
Ig strand E 523..527 CDD:409392 1/3 (33%)
Ig strand F 537..542 CDD:409392 0/4 (0%)
Ig strand G 553..556 CDD:409392 0/2 (0%)
Ig_3 584..644 CDD:464046 20/68 (29%)
Ig_3 660..738 CDD:464046 21/81 (26%)
Ig 756..844 CDD:472250 26/94 (28%)
Ig strand B 775..779 CDD:409358 0/3 (0%)
Ig strand C 788..792 CDD:409358 0/3 (0%)
Ig strand E 810..814 CDD:409358 2/3 (67%)
Ig strand F 824..829 CDD:409358 2/4 (50%)
Ig strand G 837..840 CDD:409358 1/2 (50%)
Ig <868..944 CDD:472250 12/83 (14%)
Ig strand C 881..885 CDD:409359 0/3 (0%)
Ig strand E 906..910 CDD:409359 1/3 (33%)
Ig strand F 920..925 CDD:409359 1/4 (25%)
Ig strand G 933..936 CDD:409359 0/2 (0%)
FN3 944..1043 CDD:238020 24/101 (24%)
FN3 1053..1146 CDD:238020 28/129 (22%)
fn3 1156..1244 CDD:394996 24/87 (28%)
fn3 1259..1346 CDD:394996 21/93 (23%)
DSCAMNP_001380.2 FN3 885..978 CDD:238020 26/129 (20%)
FN3 <937..1300 CDD:442628 92/389 (24%)
Ig_3 1287..1363 CDD:464046
FN3 1380..1470 CDD:238020
FN3 1486..1555 CDD:238020
Required for netrin-mediated axon repulsion of neuronal growth cones. /evidence=ECO:0000250|UniProtKB:Q9ERC8 1617..2012
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1718..1810
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1855..1883
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1971..2012
Ig 26..121 CDD:472250 4/25 (16%)
Ig strand B 42..46 CDD:409353
Ig strand C 55..59 CDD:409353
Ig strand E 79..83 CDD:409353
Ig strand F 99..104 CDD:409353 0/4 (0%)
Ig strand G 112..116 CDD:409353 0/3 (0%)
Ig 125..210 CDD:472250 20/110 (18%)
Ig strand B 141..145 CDD:409353 0/3 (0%)
Ig strand C 157..161 CDD:409353 0/3 (0%)
Ig strand E 179..183 CDD:409353 1/3 (33%)
Ig strand F 192..199 CDD:409353 2/13 (15%)
I-set 235..310 CDD:400151 22/88 (25%)
Ig strand B 242..246 CDD:409353 2/3 (67%)
Ig strand C 255..259 CDD:409353 1/3 (33%)
Ig strand F 290..295 CDD:409353 2/4 (50%)
Ig 313..395 CDD:472250 15/98 (15%)
Ig strand B 331..335 CDD:409353 0/3 (0%)
Ig strand C 344..348 CDD:409353 1/3 (33%)
Ig strand E 368..372 CDD:409353 1/3 (33%)
Ig strand F 382..387 CDD:409353 1/4 (25%)
Ig 406..501 CDD:472250 29/104 (28%)
Ig strand B 424..428 CDD:409353 2/8 (25%)
Ig strand C 437..441 CDD:409353 0/3 (0%)
Ig strand E 467..471 CDD:409353 1/3 (33%)
Ig strand F 481..486 CDD:409353 2/4 (50%)
Ig strand G 494..497 CDD:409353 0/2 (0%)
IgI_5_Dscam 504..593 CDD:409550 26/92 (28%)
Ig strand A 505..507 CDD:409550 0/1 (0%)
Ig strand A' 512..516 CDD:409550 0/3 (0%)
Ig strand B 519..526 CDD:409550 1/6 (17%)
Ig strand C 533..539 CDD:409550 1/5 (20%)
Ig strand C' 540..542 CDD:409550 1/1 (100%)
Ig strand D 549..553 CDD:409550 1/3 (33%)
Ig strand E 557..563 CDD:409550 2/5 (40%)
Ig strand F 571..579 CDD:409550 2/7 (29%)
Ig strand G 583..593 CDD:409550 3/9 (33%)
Ig 596..686 CDD:472250 5/89 (6%)
Ig strand B 613..617 CDD:409353 0/3 (0%)
Ig strand C 627..631 CDD:409353 0/3 (0%)
Ig strand E 652..656 CDD:409353 1/3 (33%)
Ig strand F 666..671 CDD:409353 0/4 (0%)
Ig strand G 679..682 CDD:409353 0/2 (0%)
Ig_DSCAM 689..784 CDD:409397 26/96 (27%)
putative Ig strand A 689..693 CDD:409397 1/3 (33%)
putative Ig strand A' 698..702 CDD:409397 0/5 (0%)
putative Ig strand B 704..714 CDD:409397 1/9 (11%)
putative Ig strand C 720..726 CDD:409397 2/5 (40%)
putative Ig strand C' 733..736 CDD:409397 0/2 (0%)
putative Ig strand D 744..747 CDD:409397 0/2 (0%)
putative Ig strand E 749..755 CDD:409397 3/5 (60%)
putative Ig strand F 762..770 CDD:409397 3/7 (43%)
putative Ig strand G 775..784 CDD:409397 2/8 (25%)
Ig_DSCAM 785..884 CDD:409398 14/103 (14%)
putative Ig strand A 785..788 CDD:409398 0/2 (0%)
putative Ig strand A' 796..800 CDD:409398 0/3 (0%)
putative Ig strand B 803..810 CDD:409398 0/6 (0%)
putative Ig strand C 818..824 CDD:409398 1/5 (20%)
putative Ig strand C' 833..836 CDD:409398 1/2 (50%)
putative Ig strand D 842..846 CDD:409398 0/3 (0%)
putative Ig strand E 848..854 CDD:409398 1/5 (20%)
putative Ig strand F 861..869 CDD:409398 2/7 (29%)
putative Ig strand G 872..882 CDD:409398 1/9 (11%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.