DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cont and Dscam

DIOPT Version :9

Sequence 1:NP_649461.2 Gene:Cont / 40553 FlyBaseID:FBgn0037240 Length:1390 Species:Drosophila melanogaster
Sequence 2:XP_038943864.1 Gene:Dscam / 171119 RGDID:619992 Length:2034 Species:Rattus norvegicus


Alignment Length:1339 Identity:280/1339 - (20%)
Similarity:457/1339 - (34%) Gaps:393/1339 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   241 LHDNRFLVQNDLNNQNINNPNQFYNSL---PGTVNQRNQNNLRGFIGPNQ---PYGDNRYV---- 295
            :|||.:....:..:..|.:.:....::   |.||...:|..:||.:...:   |.....||    
  Rat    95 IHDNTYYCTAENPSGKIRSQDVHIKAVLREPYTVRVEDQKTMRGNVAVFKCIIPSSVEAYVTVVS 159

  Fly   296 --RDRVVYAFSKKRDRWMFMPAYEIELNLFICESKVLYSSDNVNIKLDDKRPYHYGLDINDMERI 358
              :|.|......:               ..|..:..||..|..|    :...|:|       ..|
  Rat   160 WEKDTVSLVSGSR---------------FLITSTGALYIKDVQN----EDGLYNY-------RCI 198

  Fly   359 PRGPY------------FVKQPNDTT------FDVNKNRLINDVTLSCLANGYPTPSYTWYREVY 405
            .|..|            ||..|.::.      ||..|......|.|.|.|.|:|.|.|.|.::  
  Rat   199 TRHRYTGETRQSNSARLFVSDPANSAPSILDGFDHRKAMAGQRVELPCKALGHPEPDYRWLKD-- 261

  Fly   406 VDDRLE----YQKIDPLAQDRYTISGGNLIIYEPKQALDQGAYHCVAENKFGRIR---------- 456
             :..||    :||         |::|   ::.|..:..|.|:|.|...|::|..:          
  Rat   262 -NMPLELSGRFQK---------TVTG---LLIENSRPSDSGSYVCEVSNRYGTAKVIGRLYVKQP 313

  Fly   457 ------------SESAHLNFGFIMEFNLKRSAETSEMNW---------GKSIFCDPPQHYPDVRY 500
                        |..:.::....:..|     |..|::|         ||::......|      
  Rat   314 LKATISPRKVKSSVGSQVSLSCSVTGN-----EDQELSWYRNGEILNPGKNVRITGLNH------ 367

  Fly   501 YWARDYFPNFVEEDQRVFVSRDGALYFSFIETVDRANYSCTVQTLVSDTGRNGPFFPLRVTPNSN 565
                   .|.:.:.   .|..||..|..|:.. |:.:....||.::.|.           ||.  
  Rat   368 -------ANLIMDH---MVKSDGGAYQCFVRK-DKLSAQDYVQVVLEDG-----------TPK-- 408

  Fly   566 YQALIFANTFPKVFPEAPVAGDEIRLECMAFGYPIPSYNWTRQGLP-LQRNAYTINY-----GRV 624
               :|.|.:...|.|..||:     |.|...|.|:|:..||....| |:.:.:.|:.     |.|
  Rat   409 ---IISAFSEKVVSPAEPVS-----LVCNVKGTPLPTVTWTLDDDPILKGSGHRISQMITSEGNV 465

  Fly   625 ---LIIQNATTNDNGEYSCTITNPRKTLMKSIYINIQMRPQFTIPLKDMIKDYNSDVTFICEAFA 686
               |.|.::...|.|.|.||..|....::....||:: .|....|:|::......|....|....
  Rat   466 VSYLNISSSQVRDGGVYRCTANNSAGVVLYQARINVR-GPASIRPMKNITAIAGRDTYIHCRVIG 529

  Fly   687 IPDANYTWYKNAERLDPANINRDRYIIQDNVLTIKF--LEKDKDDAMYQCG--AQNQLKTS---- 743
            .|..:..|||||..| |.|   .|.:..:|..|:|.  ::|:.|:..|.|.  .|.||.||    
  Rat   530 YPYYSIKWYKNANLL-PFN---HRQVAFENNGTLKLSDVQKEVDEGEYTCNVLVQPQLSTSQSVH 590

  Fly   744 ----------------FSSAQ------------------------------------------LR 750
                            ||..|                                          ||
  Rat   591 VTVKVPPFIQPFEFPRFSIGQRVFIPCVVVSGDLPITITWQKDGRPIPASLGVTIDNIDFTSSLR 655

  Fly   751 VLSMK-----------------------------PSFKKHPLESEVYAVYNGNTTIVCDPEAAPR 786
            :.::.                             |.|...|.:.:  .:|.....:.|..|..|.
  Rat   656 ISNLSLMHNGNYTCIARNEAAAVEHQSQLIVRVPPKFVVQPRDQD--GIYGKAVILNCSAEGYPV 718

  Fly   787 PKFQWK-------KDGQVIGSGGHRRILPSGTLTISPTSRDDEGIYTCIASNQAGTDESHARVIV 844
            |...||       ...|.|...|..::|.:|:|.|.....:|.|.|.|..||..|.|.|.:..:.
  Rat   719 PTIVWKFSKGAGVPQFQPIALNGRIQVLSNGSLLIKHVVEEDSGYYLCKVSNDVGADVSKSMYLT 783

  Fly   845 LQEIRFIETPPQRIVSKEHDLIFLHCEAAFDELLDIAYVWKHNGEVLKNNHDGTGRIIVDW---- 905
            ::....|.:.|...::.:.....:.|.|..::  .|...|:....::   :....|.:|..    
  Rat   784 VKIPAMITSYPNTTLATQGQRKEMSCTAHGEK--PIIVRWEKEDRII---NPEMARYLVSTKEVG 843

  Fly   906 ----NRLTVHNTSMRDAGDYECVVKSAVNEISSKTSVSIEGAPGAPGGVQVIQISKTKA---IIE 963
                :.|.:..|...|:|.:.|...::..|......::::..|..|    .|:|...||   .:.
  Rat   844 EEVISTLQILPTVREDSGFFSCHAINSYGEDRGIIQLTVQEPPDPP----EIEIKDVKARTITLR 904

  Fly   964 WVDGSHNGRAIRYYNILGRTNWNRTWVNVSTHVQAREVDRYTSRQQAEVVNLTPWSAYEFSVTAV 1028
            |..|......|..|:|..: |.:.:|.:..     |..|.......|.::::.|.|.|...:.|.
  Rat   905 WTMGFDGNSPITGYDIECK-NKSDSWDSAQ-----RTKDVSPQLNSATIIDIHPSSTYSIRMYAK 963

  Fly  1029 NDLGIGTPSAPSPIYSTYEDKPYIAPRNVGGGGGKIGDLTITWDPLL----PQEQH-----SHGI 1084
            |.:|...||                           .::|||.|...    |||.|     |..|
  Rat   964 NRIGKSEPS---------------------------NEITITADEAAPDGPPQEVHLEPTSSQSI 1001

  Fly  1085 HYKVFWK----------LKG-------------------AIEWASD-EIKKQDHMGVAVVNIPLN 1119
              :|.||          ::|                   :|:...| |:...|::          
  Rat  1002 --RVTWKAPKKHLQNGIIRGYQIGYREYSTGGNFQFNIISIDTTGDSEVYTLDNL---------- 1054

  Fly  1120 NYYTEYEVKVQAINSVGKGPESEIAVIHSAEDMPQVAPQKPIALAYNSTCFNVTWQPIDMSRENI 1184
            |.:|:|.:.|||.|..|.||.|:..:..:.||:|...|:...|:|.:....:::|.  .:|:|.:
  Rat  1055 NKFTQYGLVVQACNRAGTGPSSQEIITTTLEDVPSYPPENVQAIATSPESISISWS--TLSKEAL 1117

  Fly  1185 RGKLIGHRLKYWKTTHQEEDSVYYLSRTTRNWALIVGLQPDTYYFVKVMAYNAAGEGPESERFEE 1249
            .|.|.|.|:.||......|........||:....:.||:..|.|.::|:|:..||:|..||:...
  Rat  1118 NGILQGFRVIYWANLIDGELGEIKNVTTTQPSLELDGLEKYTNYSIQVLAFTRAGDGVRSEQIFT 1182

  Fly  1250 RTYRKAPQKPPSSVHVYGINPSTVRVVWRYVSPSQDEEPVEGYKVRIWESDQNMITANNTIVPIG 1314
            ||....| .||:.|.....:.|.|.|.|  :.|.:....:..|.|          ..::....:.
  Rat  1183 RTKEDVP-GPPAGVKAAAASASMVFVSW--LPPLKLNGIIRKYTV----------FCSHPYPTVI 1234

  Fly  1315 QKLE------SY-INNLTPGKSYNMRVLAYSNGGDGRMS 1346
            .:.|      || |.||:..:.|::.|:|.::.|.|..|
  Rat  1235 SEFEASPDSFSYRIPNLSRNRQYSVWVVAVTSAGRGNSS 1273

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ContNP_649461.2 CLECT 139..>223 CDD:214480
Ig 361..460 CDD:299845 30/142 (21%)
I-set 362..462 CDD:254352 30/143 (21%)
Ig 466..559 CDD:299845 17/101 (17%)
IG_like 584..657 CDD:214653 22/81 (27%)
IGc2 586..645 CDD:197706 19/67 (28%)
Ig 667..751 CDD:299845 29/149 (19%)
IG_like 676..751 CDD:214653 28/140 (20%)
IG_like 765..844 CDD:214653 23/85 (27%)
Ig 773..844 CDD:299845 22/77 (29%)
I-set 851..940 CDD:254352 14/96 (15%)
Ig 866..944 CDD:299845 12/85 (14%)
FN3 944..1043 CDD:238020 24/101 (24%)
FN3 1053..1146 CDD:238020 29/131 (22%)
fn3 1156..1244 CDD:278470 24/87 (28%)
fn3 1259..1346 CDD:278470 21/93 (23%)
DscamXP_038943864.1 Ig 26..121 CDD:416386 4/25 (16%)
Ig strand A' 33..37 CDD:409353
Ig strand B 40..49 CDD:409353
Ig strand C 55..61 CDD:409353
Ig strand C' 63..66 CDD:409353
Ig strand D 72..75 CDD:409353
Ig strand E 80..85 CDD:409353
Ig strand F 98..106 CDD:409353 1/7 (14%)
Ig strand G 109..121 CDD:409353 1/11 (9%)
Ig 125..210 CDD:416386 21/110 (19%)
Ig strand A 126..130 CDD:409353 2/3 (67%)
Ig strand A' 132..136 CDD:409353 1/3 (33%)
Ig strand B 139..149 CDD:409353 0/9 (0%)
Ig strand C 157..163 CDD:409353 0/5 (0%)
Ig strand C' 164..167 CDD:409353 1/2 (50%)
Ig strand E 179..185 CDD:409353 2/5 (40%)
Ig strand F 191..201 CDD:409353 3/16 (19%)
IGc2 239..300 CDD:197706 21/75 (28%)
Ig strand B 242..246 CDD:409353 2/3 (67%)
Ig strand C 255..259 CDD:409353 1/3 (33%)
Ig strand F 290..295 CDD:409353 2/4 (50%)
Ig 313..395 CDD:416386 15/103 (15%)
Ig strand A 314..319 CDD:409353 0/4 (0%)
Ig strand A' 322..326 CDD:409353 0/3 (0%)
Ig strand B 329..339 CDD:409353 0/9 (0%)
Ig strand C 344..350 CDD:409353 2/5 (40%)
Ig strand C' 351..354 CDD:409353 0/2 (0%)
Ig strand E 368..374 CDD:409353 1/5 (20%)
Ig strand F 381..389 CDD:409353 2/7 (29%)
Ig 406..501 CDD:416386 29/104 (28%)
Ig strand A 406..409 CDD:409353 2/7 (29%)
Ig strand A' 415..419 CDD:409353 0/3 (0%)
Ig strand B 422..431 CDD:409353 4/13 (31%)
Ig strand C 436..442 CDD:409353 2/5 (40%)
Ig strand C' 444..447 CDD:409353 0/2 (0%)
Ig strand D 452..460 CDD:409353 1/7 (14%)
Ig strand E 464..473 CDD:409353 3/8 (38%)
Ig strand F 480..488 CDD:409353 4/7 (57%)
Ig strand G 491..501 CDD:409353 1/9 (11%)
Ig 504..593 CDD:416386 27/92 (29%)
Ig strand A 505..507 CDD:409353 0/1 (0%)
Ig strand A' 512..516 CDD:409353 0/3 (0%)
Ig strand B 519..526 CDD:409353 1/6 (17%)
Ig strand C 533..539 CDD:409353 1/5 (20%)
Ig strand C' 540..542 CDD:409353 1/1 (100%)
Ig strand D 549..553 CDD:409353 1/3 (33%)
Ig strand E 557..563 CDD:409353 2/5 (40%)
Ig strand F 571..579 CDD:409353 2/7 (29%)
Ig strand G 583..593 CDD:409353 3/9 (33%)
Ig 596..686 CDD:416386 5/89 (6%)
Ig strand A 597..599 CDD:409353 0/1 (0%)
Ig strand B 611..620 CDD:409353 1/8 (13%)
Ig strand C 625..632 CDD:409353 0/6 (0%)
Ig strand C' 634..636 CDD:409353 0/1 (0%)
Ig strand D 643..648 CDD:409353 0/4 (0%)
Ig strand E 651..658 CDD:409353 2/6 (33%)
Ig strand F 665..673 CDD:409353 0/7 (0%)
Ig strand G 676..685 CDD:409353 0/8 (0%)
Ig_DSCAM 689..784 CDD:409397 26/96 (27%)
Ig strand B 707..711 CDD:409397 0/3 (0%)
Ig strand C 720..724 CDD:409397 0/3 (0%)
Ig strand E 749..753 CDD:409397 2/3 (67%)
Ig strand F 763..768 CDD:409397 2/4 (50%)
Ig strand G 777..780 CDD:409397 1/2 (50%)
Ig_DSCAM 785..884 CDD:409398 14/103 (14%)
Ig strand B 805..809 CDD:409398 0/3 (0%)
Ig strand C 818..822 CDD:409398 0/3 (0%)
Ig strand E 848..852 CDD:409398 1/3 (33%)
Ig strand F 862..867 CDD:409398 1/4 (25%)
Ig strand G 875..878 CDD:409398 0/2 (0%)
FN3 885..978 CDD:238020 25/129 (19%)
FN3 986..1083 CDD:238020 25/108 (23%)
FN3 1091..1184 CDD:238020 26/94 (28%)
FN3 1189..1278 CDD:238020 23/98 (23%)
Ig_3 1287..1363 CDD:404760
Ig strand B 1303..1307 CDD:409353
Ig strand C 1316..1320 CDD:409353
Ig strand E 1342..1346 CDD:409353
Ig strand F 1356..1361 CDD:409353
FN3 1380..1470 CDD:238020
FN3 1486..1555 CDD:238020
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10075
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
22.100

Return to query results.
Submit another query.