DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cont and CNTN1

DIOPT Version :10

Sequence 1:NP_649461.2 Gene:Cont / 40553 FlyBaseID:FBgn0037240 Length:1390 Species:Drosophila melanogaster
Sequence 2:NP_001834.2 Gene:CNTN1 / 1272 HGNCID:2171 Length:1018 Species:Homo sapiens


Alignment Length:1051 Identity:328/1051 - (31%)
Similarity:495/1051 - (47%) Gaps:122/1051 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   344 RPYHYGLDINDMERIPRGPYFVKQPNDTTFDVNKNRLINDVTLSCLANGYPTPSYTWYREVYVDD 408
            |.|.:|:...|.   ..||.|.:||.:|.:.  :..|...|:|:|.|...|.|.|.|        
Human    26 RRYGHGVSEEDK---GFGPIFEEQPINTIYP--EESLEGKVSLNCRARASPFPVYKW-------- 77

  Fly   409 RLEYQKIDPLAQDRYTISGGNLIIYEPKQALDQGAYHCVAENKFGRIRSESAHLNFGFIMEFNLK 473
            |:....:| |..|||::.||||:|..|.:..|.|.|:|:|.|.:|.:||..|.|:||::..|..:
Human    78 RMNNGDVD-LTSDRYSMVGGNLVINNPDKQKDAGIYYCLASNNYGMVRSTEATLSFGYLDPFPPE 141

  Fly   474 RSAETSEMNWGKS--IFCDPPQHYP-DVRYYWARDYFPNFVEEDQRVFVSR-DGALYFSFIETVD 534
            ...|. .:..||.  :.||||.|:| |:.|.|..:.||.|:..|:|.|||: :|.||.:.:|..|
Human   142 ERPEV-RVKEGKGMVLLCDPPYHFPDDLSYRWLLNEFPVFITMDKRRFVSQTNGNLYIANVEASD 205

  Fly   535 RANYSCTVQTLVSDTGRNGPFFPLRVTPNSN---YQALIFANTFPKVFPEAPVAGDEIRLECMAF 596
            :.||||.|.:..........|.||...|...   |.|.|... |..|:   .:.|..:.|||.|.
Human   206 KGNYSCFVSSPSITKSVFSKFIPLIPIPERTTKPYPADIVVQ-FKDVY---ALMGQNVTLECFAL 266

  Fly   597 GYPIPSYNWTRQGLPLQRNAYTINYGRVLIIQNATTNDNGEYSCTITNPRKTLMKSIYINIQMRP 661
            |.|:|...|.:...|:...|.....|.||.|.|....|.|.|.|...|.|........|.:|..|
Human   267 GNPVPDIRWRKVLEPMPSTAEISTSGAVLKIFNIQLEDEGIYECEAENIRGKDKHQARIYVQAFP 331

  Fly   662 QFTIPLKDMIKDYNSDVTFICEAFAIPDANYTWYKNAERLDPANINRDRYIIQDNVLTIKFLEKD 726
            ::...:.|...|..||:.:.|.|...|.....|.||........:         .:..:.|    
Human   332 EWVEHINDTEVDIGSDLYWPCVATGKPIPTIRWLKNGYAYHKGEL---------RLYDVTF---- 383

  Fly   727 KDDAMYQCGAQNQLKTSFSSAQLRVLSMKPSFKKHPLESEVYAVYNGNTTIVCDPEAAPRPKFQW 791
            ::..||||.|:|.....:::|:|::|::.|:|:.:|::.::.|...|...|.|.|:|||:|||.|
Human   384 ENAGMYQCIAENTYGAIYANAELKILALAPTFEMNPMKKKILAAKGGRVIIECKPKAAPKPKFSW 448

  Fly   792 KKDGQVIGSGGHRRILPSGTLTISPTSRDDEGIYTCIASNQAGTDESHARVIVLQEIRFIETPPQ 856
            .|..:.:.:.....|...|:|.|:..:|:|.|||||.|.|..|...|...:::....|.|..|..
Human   449 SKGTEWLVNSSRILIWEDGSLEINNITRNDGGIYTCFAENNRGKANSTGTLVITDPTRIILAPIN 513

  Fly   857 RIVSKEHDLIFLHCEAAFDELLDIAYVWKHNGEVL---KNNHDGTGRIIVDWN-RLTVHNTSMRD 917
            ..::...:.. :.|.|:||..||:.:||..||.|:   |.|.......::|.| .|.:.|..::.
Human   514 ADITVGENAT-MQCAASFDPALDLTFVWSFNGYVIDFNKENIHYQRNFMLDSNGELLIRNAQLKH 577

  Fly   918 AGDYECVVKSAVNEISSKTSVSIEGAPGAPGGVQVIQISKTKAIIEWVDGSHNGRAIRYYNILGR 982
            ||.|.|..::.|:..|:...:.:.|.||.|||:::..|..|...:.|..||.|...|..|.|..:
Human   578 AGRYTCTAQTIVDNSSASADLVVRGPPGPPGGLRIEDIRATSVALTWSRGSDNHSPISKYTIQTK 642

  Fly   983 TNWNRTWVNVSTHVQAREVDRYTSRQQAEVVNLTPWSAYEFSVTAVNDLGIGTPSAPSPIYSTYE 1047
            |..:..|.:..|.....|    .:.:.|..|:|.||..|||.|.|.|.||.|.||.||....|..
Human   643 TILSDDWKDAKTDPPIIE----GNMEAARAVDLIPWMEYEFRVVATNTLGRGEPSIPSNRIKTDG 703

  Fly  1048 DKPYIAPRNVGGGGGKIGDLTITWDPLLPQEQHSHGIHYKVFWKLKGAIEWASDEIKKQDHMGVA 1112
            ..|.:||.:||||||:..:|||||.||..:..:.:...|.|.:|.....||     ||     |.
Human   704 AAPNVAPSDVGGGGGRNRELTITWAPLSREYHYGNNFGYIVAFKPFDGEEW-----KK-----VT 758

  Fly  1113 VVNIPLNNYY---------TEYEVKVQAINSVGKGPESEIAVIHSAEDMPQVAPQKPIALAYNST 1168
            |.|.....|.         |.::|||:|.|:.|.||.|.:|||:||:|.|..||.:......:|:
Human   759 VTNPDTGRYVHKDETMSPSTAFQVKVKAFNNKGDGPYSLVAVINSAQDAPSEAPTEVGVKVLSSS 823

  Fly  1169 CFNVTWQPIDMSRENIRGKLI-GHRLKYWKTTHQEEDSVYYLSRTTRNW-ALIVGLQPDTYYFVK 1231
            ..:|.|       |::..|:: .::::|| ..|.:|::...:..|::.: |.:..|.|||.||::
Human   824 EISVHW-------EHVLEKIVESYQIRYW-AAHDKEEAANRVQVTSQEYSARLENLLPDTQYFIE 880

  Fly  1232 VMAYNAAGEGPESERFEERTYRKAPQKPPSSVHVYGINPSTVR------VVWRYVSPSQDEEPVE 1290
            |.|.|:||.||.|:..|..|.:..|.:||..:       |:||      :.|.:|....:|..|.
Human   881 VGACNSAGCGPPSDMIEAFTKKAPPSQPPRII-------SSVRSGSRYIITWDHVVALSNESTVT 938

  Fly  1291 GYKV----------RIWESDQNMITANNTIVPIGQKLESYINNLTPGKSYNMRVLAYSNGGDGRM 1345
            ||||          :::.:.::.|.     |||.:..|           |.:.|.|:|:||||.:
Human   939 GYKVLYRPDGQHDGKLYSTHKHSIE-----VPIPRDGE-----------YVVEVRAHSDGGDGVV 987

  Fly  1346 S------SPTL 1350
            |      :|||
Human   988 SQVKISGAPTL 998

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ContNP_649461.2 CLECT 139..>223 CDD:214480
Ig 361..466 CDD:472250 39/104 (38%)
Ig strand B 384..388 CDD:409356 2/3 (67%)
Ig strand C 397..409 CDD:409356 2/11 (18%)
Ig strand E 428..432 CDD:409356 3/3 (100%)
Ig strand F 443..448 CDD:409356 2/4 (50%)
Ig strand G 457..460 CDD:409356 1/2 (50%)
Ig 474..559 CDD:472250 32/88 (36%)
Ig strand B 485..489 CDD:409392 1/5 (20%)
Ig strand C 499..503 CDD:409392 1/3 (33%)
Ig strand E 523..527 CDD:409392 2/3 (67%)
Ig strand F 537..542 CDD:409392 4/4 (100%)
Ig strand G 553..556 CDD:409392 0/2 (0%)
Ig_3 584..644 CDD:464046 20/59 (34%)
Ig_3 660..738 CDD:464046 17/77 (22%)
Ig 756..844 CDD:472250 31/87 (36%)
Ig strand B 775..779 CDD:409358 1/3 (33%)
Ig strand C 788..792 CDD:409358 2/3 (67%)
Ig strand E 810..814 CDD:409358 2/3 (67%)
Ig strand F 824..829 CDD:409358 4/4 (100%)
Ig strand G 837..840 CDD:409358 1/2 (50%)
Ig <868..944 CDD:472250 24/79 (30%)
Ig strand C 881..885 CDD:409359 1/3 (33%)
Ig strand E 906..910 CDD:409359 2/4 (50%)
Ig strand F 920..925 CDD:409359 2/4 (50%)
Ig strand G 933..936 CDD:409359 1/2 (50%)
FN3 944..1043 CDD:238020 36/98 (37%)
FN3 1053..1146 CDD:238020 37/101 (37%)
fn3 1156..1244 CDD:394996 26/89 (29%)
fn3 1259..1346 CDD:394996 26/102 (25%)
CNTN1NP_001834.2 IgI_1_Contactin-1 40..134 CDD:409436 39/104 (38%)
Ig strand A 42..46 CDD:409436 1/3 (33%)
Ig strand A' 49..54 CDD:409436 1/6 (17%)
Ig strand B 60..68 CDD:409436 3/7 (43%)
Ig strand C 73..79 CDD:409436 3/13 (23%)
Ig strand C' 81..84 CDD:409436 0/2 (0%)
Ig strand D 90..94 CDD:409436 2/3 (67%)
Ig strand E 96..102 CDD:409436 4/5 (80%)
Ig strand F 109..118 CDD:409436 4/8 (50%)
Ig strand G 121..134 CDD:409436 6/12 (50%)
Ig2_Contactin-2-like 142..230 CDD:409392 32/88 (36%)
Ig strand A 144..149 CDD:409392 1/5 (20%)
Ig strand B 153..159 CDD:409392 0/5 (0%)
Ig strand C 168..174 CDD:409392 2/5 (40%)
Ig strand C' 179..181 CDD:409392 0/1 (0%)
Ig strand D 186..191 CDD:409392 3/4 (75%)
Ig strand E 194..198 CDD:409392 2/3 (67%)
Ig strand F 208..216 CDD:409392 5/7 (71%)
Ig strand G 218..230 CDD:409392 2/11 (18%)
IgI_3_Contactin-1 241..328 CDD:143259 27/90 (30%)
Ig strand A 241..246 CDD:143259 2/4 (50%)
Ig strand A' 249..254 CDD:143259 1/7 (14%)
Ig strand B 257..266 CDD:143259 3/8 (38%)
Ig strand C 272..276 CDD:143259 0/3 (0%)
Ig strand C' 279..281 CDD:143259 0/1 (0%)
Ig strand D 289..292 CDD:143259 0/2 (0%)
Ig strand E 293..298 CDD:143259 2/4 (50%)
Ig strand F 306..314 CDD:143259 3/7 (43%)
Ig strand G 317..328 CDD:143259 1/10 (10%)
Ig 332..408 CDD:472250 19/88 (22%)
Ig strand B 348..352 CDD:143205 0/3 (0%)
Ig strand C 361..365 CDD:143205 0/3 (0%)
Ig strand E 374..378 CDD:143205 0/12 (0%)
Ig strand F 388..393 CDD:143205 4/4 (100%)
Ig strand G 401..404 CDD:143205 0/2 (0%)
Ig5_Contactin-1 413..501 CDD:409438 31/87 (36%)
Ig strand A 413..418 CDD:409438 2/4 (50%)
Ig strand A' 421..426 CDD:409438 0/4 (0%)
Ig strand B 430..437 CDD:409438 2/6 (33%)
Ig strand C 445..449 CDD:409438 2/3 (67%)
Ig strand D 463..466 CDD:409438 1/2 (50%)
Ig strand E 467..472 CDD:409438 2/4 (50%)
Ig strand F 480..488 CDD:409438 6/7 (86%)
Ig strand G 494..501 CDD:409438 1/6 (17%)
Ig6_Contactin 503..601 CDD:409359 26/98 (27%)
Ig strand A 503..509 CDD:409359 1/5 (20%)
Ig strand A' 512..517 CDD:409359 0/4 (0%)
Ig strand B 520..528 CDD:409359 1/8 (13%)
Ig strand C 537..541 CDD:409359 1/3 (33%)
Ig strand D 562..565 CDD:409359 1/2 (50%)
Ig strand E 566..570 CDD:409359 1/3 (33%)
Ig strand F 579..586 CDD:409359 3/6 (50%)
Ig strand G 593..597 CDD:409359 1/3 (33%)
FN3 610..697 CDD:238020 30/90 (33%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 693..717 10/23 (43%)
FN3 <745..>945 CDD:442628 69/224 (31%)
fn3 811..893 CDD:394996 26/89 (29%)
FN3 905..989 CDD:238020 27/106 (25%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.