DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cont and cntn2

DIOPT Version :9

Sequence 1:NP_649461.2 Gene:Cont / 40553 FlyBaseID:FBgn0037240 Length:1390 Species:Drosophila melanogaster
Sequence 2:XP_031752703.1 Gene:cntn2 / 100487049 XenbaseID:XB-GENE-6070188 Length:1033 Species:Xenopus tropicalis


Alignment Length:1070 Identity:309/1070 - (28%)
Similarity:476/1070 - (44%) Gaps:113/1070 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   361 GPYFVKQPNDTTFDVNKNRLINDVTLSCLANGYPTPSYTWYREVYVDDRLEYQKIDPLAQDRYTI 425
            ||.|.:||.:|.|.  ...:...|||.|.|...|:.:|.|        :|...:::..|...|.:
 Frog    31 GPVFEEQPENTLFP--DGSIEEQVTLPCRARASPSATYRW--------QLNGTELNLTADPSYRL 85

  Fly   426 SGGNLIIYEPKQALDQGAYHCVAENKFGRIRSESAHLNFGFIMEFNLKR--SAETSEMNWGKSIF 488
            .||||.|..|.|:...|.|.|:|.|..|.:.|..|.|.||::.||..::  :.:.:| .||..:.
 Frog    86 VGGNLAISGPTQSKHAGTYQCIASNPKGTVLSSEASLRFGYLQEFPAEQRDTVKVTE-GWGVMLA 149

  Fly   489 CDPPQHYPDVRYYWARDYFPNFVEEDQRVFVSR-DGALYFSFIETVDRANYSCTVQTLVSDTGRN 552
            |:||:|||.:.|.|..:.||.|:..|.|.|||: .|.||.:.....|...|||...:.:|.|.::
 Frog   150 CNPPKHYPGLSYRWLLNEFPTFLNTDNRRFVSQVTGNLYVAQTVKEDEGAYSCLTTSHISFTTKS 214

  Fly   553 --GPFFPLRVTPNSNYQALIFANTFPKVFPEAPVA--GDEIRLECMAFGYPIPSYNWTRQGLPLQ 613
              ..|..|.|  ||..:...:|.:....||....|  |..:.|||.|||.|:|...|.:....|.
 Frog   215 VYSSFTQLNV--NSEVKPRTYAPSIKVRFPGETYALYGQAVFLECFAFGNPVPHIRWRKVDGTLP 277

  Fly   614 RNAYTINYGRVLIIQNATTNDNGEYSCTITNPRKTLMKSIYINIQMRPQFTIPLKDMIKDYNSDV 678
            .....|:  .||...:.|..::|.|.|...|...:......:.:|.:|::...:.|......||:
 Frog   278 PRLLVID--PVLHFPSITFEEDGTYECEAVNSEGSTTHQGRVIVQAQPEWLHVITDTEAKIGSDL 340

  Fly   679 TFICEAFAIPDANYTWYKNAERLDPANINRDRYIIQDNV-LT---IKFLEKD-KDDAMYQCGAQN 738
            .:.|.|...|.....|.::.:.|          :.|.|: :|   |||.... .|..||||.|:|
 Frog   341 LWSCAASGKPRPTIRWLRDGKPL----------MTQVNIEITNGQIKFTSLSLHDSGMYQCVAEN 395

  Fly   739 QLKTSFSSAQLRVLSMKPSFKKHPLESEVYAVYNGNTTIVCDPEAAPRPKFQWKKDGQVIGSGGH 803
            :..|.:::|:|.|.::.|.|:..|::..:.|...|...|.|:|.|||.|...|.|..:::.:...
 Frog   396 KHGTIYTTAELTVQALAPDFRLSPVKRLIPAARGGEVIIQCNPRAAPTPLILWSKGTELLFNSSR 460

  Fly   804 RRILPSGTLTISPTSRDDEGIYTCIASNQAGTDESHARVIVLQEIRFIETPPQRIVSKEHDLIFL 868
            ..:..:|||.:...||.|||.|||.|.|..|...| ..|:.::|...|...|......:.|.|.|
 Frog   461 VTVTANGTLILRNISRSDEGKYTCFAENIMGKSNS-TGVLSVREATKITLAPSGSDINQGDSITL 524

  Fly   869 HCEAAFDELLDIAYVWKHNGEVLKNNHDGTGRIIVDWNR----------------LTVHNTSMRD 917
            .|.|:.|..:|:.:.|..||            |.:|:.:                |.:.|..:|.
 Frog   525 QCHASHDPSMDLTFTWTLNG------------IPIDFEKEAQNYRRTSMDEAVGDLHIINAQLRH 577

  Fly   918 AGDYECVVKSAVNEISSKTSVSIEGAPGAPGGVQVIQISKTKAIIEWVDGSHNGRAIRYYNILGR 982
            ||.|.|:.::.|:..|:..|:.|.|.||.||||.|..:.:|...:.|..|..|...|..|.:..|
 Frog   578 AGKYTCMAQTVVDRTSAMASLLIRGPPGPPGGVVVKYVGETMVQLSWSRGFDNHSPISRYVVQVR 642

  Fly   983 TNWNRTWVNVSTHVQAREVDRYTSRQQAEVVNLTPWSAYEFSVTAVNDLGIGTPSAPSPIYSTYE 1047
            ......|.:..|.....|    .:.:.|.||.|..|:.|.|.:.|.|.||.|.|||||.:..|.|
 Frog   643 EPLTEIWRSARTDPPTVE----GNAESALVVGLNQWTDYLFRIVASNILGDGDPSAPSALIRTRE 703

  Fly  1048 DKPYIAPRNVGGGGGKIGDLTITWDPLLPQEQHSHGIHYKVFWKLKGAIEWASDEI---KKQDHM 1109
            ..|.:||..||||||...:|||.|.|:..|.|:.....|.:.:|.|....|.:..:   :.|.::
 Frog   704 AAPNVAPSEVGGGGGAPNELTINWTPIGRQYQNGDDFGYIIAFKRKNENTWLTVRVPGGQSQQYV 768

  Fly  1110 ----GVAVVNIPLNNYYTEYEVKVQAINSVGKGPESEIAVIHSAEDMPQVAPQKPIALAYNSTCF 1170
                .:|.        ||.::||:|..|..|:||.|....::|||:.|::.|.:..|.|.:|:..
 Frog   769 YRNESIAA--------YTPFDVKIQGYNKKGEGPFSRDTTVYSAEEEPRMFPSEVKATAISSSDI 825

  Fly  1171 NVTWQPIDMSRENIRGKLIGHRLKYWKTTHQEEDSVYYLSRTTRNWALIVGLQPDTYYFVKVMAY 1235
            .|.|.|:    :.::|.|:|:.::||||:.:|..:....|......|.:..|:|||.|:|.|..|
 Frog   826 EVAWNPV----QTLKGVLLGYEIRYWKTSDKEAAADRVRSAGMATTAHVTSLKPDTTYYVTVRVY 886

  Fly  1236 NAAGEGPESERFEERTYRKAPQKPPSSVHVYGINPSTVRVVWRYVSPSQDEEPVEGYKVRIWESD 1300
            |.||.||.|......|.:....|.|.::. :.::..::.:.|..|...|:|..|.|||:      
 Frog   887 NQAGTGPSSPATNVTTSKAPSSKLPENIK-WTLSRKSLSIKWNPVVALQNESSVTGYKI------ 944

  Fly  1301 QNMITANNTIVPIGQKLESYINNLT-------PG-KSYNMRVLAYSNGGDGRMSSPTLHFQMGKT 1357
              :...::...||     .|:.:.|       .| .:..:::.|...||||..:.  :|......
 Frog   945 --LYRMSHHSTPI-----LYVTSKTHIELPFPEGFSTVTIQLRATGKGGDGEPAE--VHIPTDSG 1000

  Fly  1358 TRNGANTRHGHNINTALILSTLLLISTFLY 1387
            |...........|...|...|..|:....|
 Frog  1001 TSMMVENSASRPITQTLAAKTTTLLFLIRY 1030

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ContNP_649461.2 CLECT 139..>223 CDD:214480
Ig 361..460 CDD:299845 32/98 (33%)
I-set 362..462 CDD:254352 32/99 (32%)
Ig 466..559 CDD:299845 31/97 (32%)
IG_like 584..657 CDD:214653 20/74 (27%)
IGc2 586..645 CDD:197706 18/58 (31%)
Ig 667..751 CDD:299845 24/88 (27%)
IG_like 676..751 CDD:214653 23/79 (29%)
IG_like 765..844 CDD:214653 27/78 (35%)
Ig 773..844 CDD:299845 26/70 (37%)
I-set 851..940 CDD:254352 24/104 (23%)
Ig 866..944 CDD:299845 23/93 (25%)
FN3 944..1043 CDD:238020 34/98 (35%)
FN3 1053..1146 CDD:238020 31/99 (31%)
fn3 1156..1244 CDD:278470 30/87 (34%)
fn3 1259..1346 CDD:278470 19/94 (20%)
cntn2XP_031752703.1 Ig 324..408 CDD:416386 24/93 (26%)
Ig strand A 324..327 CDD:409353 0/2 (0%)
Ig strand A' 331..335 CDD:409353 1/3 (33%)
Ig strand B 339..347 CDD:409353 2/7 (29%)
Ig strand C 353..358 CDD:409353 1/4 (25%)
Ig strand C' 360..363 CDD:409353 0/2 (0%)
Ig strand D 368..372 CDD:409353 1/3 (33%)
Ig strand E 374..379 CDD:409353 2/4 (50%)
Ig strand F 388..395 CDD:409353 5/6 (83%)
Ig strand G 399..408 CDD:409353 3/8 (38%)
Ig5_Contactin 413..501 CDD:409358 30/88 (34%)
Ig strand B 432..436 CDD:409358 1/3 (33%)
Ig strand C 445..449 CDD:409358 0/3 (0%)
Ig strand E 467..471 CDD:409358 3/3 (100%)
Ig strand F 481..486 CDD:409358 3/4 (75%)
Ig strand G 494..497 CDD:409358 1/3 (33%)
Ig 503..601 CDD:416386 25/109 (23%)
Ig strand A 503..509 CDD:409353 2/5 (40%)
Ig strand A' 512..517 CDD:409353 0/4 (0%)
Ig strand B 520..528 CDD:409353 4/7 (57%)
Ig strand C 537..541 CDD:409353 0/3 (0%)
Ig strand D 562..565 CDD:409353 0/2 (0%)
Ig strand E 566..570 CDD:409353 1/3 (33%)
Ig strand F 579..586 CDD:409353 3/6 (50%)
Ig strand G 593..597 CDD:409353 1/3 (33%)
FN3 615..696 CDD:238020 25/84 (30%)
FN3 709..802 CDD:238020 31/100 (31%)
FN3 812..902 CDD:238020 31/93 (33%)
FN3 911..997 CDD:238020 20/101 (20%)
Ig 30..126 CDD:416386 35/104 (34%)
Ig strand A 33..37 CDD:409353 1/3 (33%)
Ig strand A' 40..45 CDD:409353 2/6 (33%)
Ig strand B 51..59 CDD:409353 4/7 (57%)
Ig strand C 64..70 CDD:409353 2/13 (15%)
Ig strand C' 72..75 CDD:409353 0/2 (0%)
Ig strand D 82..86 CDD:409353 1/3 (33%)
Ig strand E 88..94 CDD:409353 4/5 (80%)
Ig strand F 101..110 CDD:409353 4/8 (50%)
Ig strand G 113..126 CDD:409353 5/12 (42%)
Ig 134..223 CDD:416386 29/89 (33%)
Ig strand A 136..141 CDD:409353 0/4 (0%)
Ig strand B 145..151 CDD:409353 1/5 (20%)
Ig strand C 159..165 CDD:409353 2/5 (40%)
Ig strand C' 170..172 CDD:409353 0/1 (0%)
Ig strand D 177..182 CDD:409353 3/4 (75%)
Ig strand E 185..189 CDD:409353 2/3 (67%)
Ig strand F 199..207 CDD:409353 3/7 (43%)
Ig strand G 209..223 CDD:409353 3/13 (23%)
Ig 235..320 CDD:416386 22/86 (26%)
Ig strand A 235..240 CDD:409353 0/4 (0%)
Ig strand A' 243..248 CDD:409353 0/4 (0%)
Ig strand B 251..260 CDD:409353 3/8 (38%)
Ig strand C 266..270 CDD:409353 0/3 (0%)
Ig strand C' 273..275 CDD:409353 0/1 (0%)
Ig strand D 281..284 CDD:409353 0/2 (0%)
Ig strand E 285..290 CDD:409353 2/4 (50%)
Ig strand F 298..306 CDD:409353 3/7 (43%)
Ig strand G 309..320 CDD:409353 0/10 (0%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 73 1.000 Domainoid score I9051
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 475 1.000 Inparanoid score I1449
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D292460at33208
OrthoFinder 1 1.000 - - FOG0000550
OrthoInspector 1 1.000 - - otm48919
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X342
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
77.060

Return to query results.
Submit another query.