DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cont and cntn4

DIOPT Version :9

Sequence 1:NP_649461.2 Gene:Cont / 40553 FlyBaseID:FBgn0037240 Length:1390 Species:Drosophila melanogaster
Sequence 2:NP_001135636.1 Gene:cntn4 / 100216195 XenbaseID:XB-GENE-492899 Length:1028 Species:Xenopus tropicalis


Alignment Length:1052 Identity:321/1052 - (30%)
Similarity:504/1052 - (47%) Gaps:78/1052 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   360 RGPYFVKQPNDTTFDV-NKNRLINDVTLSCLANGYPTPSYTWYREVYVDDRLEYQKIDPLAQDRY 423
            :||.|.::|.:..|.: :::|.:.   |.|...|:|.|...|        |:....:|.....||
 Frog    23 QGPVFTQEPPNINFPLDSEDRTLR---LVCEVQGHPKPVVRW--------RVNGTLMDEAQDYRY 76

  Fly   424 TISGGNLIIYEPKQALDQGAYHCVAENKFGRIRSESAHLNFGFIMEFNLK-RSAETSEMNWGKSI 487
            .:...:|||..|.:..|.|.:.|.|.|..|.|.|..|::.|.::..|..: ||..:.....|..:
 Frog    77 RVLDRSLIIASPDRNRDVGTFQCEATNSLGTILSREAYVQFSYLDSFQTRTRSTVSVREGQGMVL 141

  Fly   488 FCDPPQHYPDVRYYWARDYFPNFVEEDQRVFVSR-DGALYFSFIETVDRANYSCTVQTLVSDTGR 551
            .|.||.|..::.|.|..:.:|.||::|.|.|||: .|.||.:.:|..|..||:|.|...|::|..
 Frog   142 LCGPPAHSGELVYAWIFNEYPPFVQQDNRRFVSQVTGNLYIAKVEPSDAGNYTCVVTNTVTNTRE 206

  Fly   552 NGPFFPLRVTPNSNYQALIFANTFPKV---FPEA-PVA-GDEIRLECMAFGYPIPSYNWTR-QGL 610
            .||..||.:..:.     :.....||:   |||: |.| |..::|||.|.|.|:|:..|.| .|.
 Frog   207 LGPSTPLTLRTDG-----VMGEYEPKIEVHFPESVPSAKGSTVKLECFALGNPVPTITWRRADGK 266

  Fly   611 PLQRNAYTINYGRVLIIQNATTNDNGEYSCTITNPRKTLMKSIYINIQMRPQFTIPLKDMIKDYN 675
            |:.|.........||.|.|....|.|.|.|...|.|...|....:.....|.:...:.|......
 Frog   267 PISRKVRRHRSSGVLEIPNFQQEDAGPYECVAENTRGKNMVRGQLTYFAPPTWVQKINDAHIAIE 331

  Fly   676 SDVTFICEAFAIPDANYTWYKNAERLDPANINRDRYIIQDNVLTIKFLEKDKDDAMYQCGAQNQL 740
            .::.:.|:|...|.|:|||.||.:||.    ::.|..|....|||..: ...|..||||.|:|:.
 Frog   332 ENILWECKASGRPKASYTWLKNGQRLQ----SKGRLQIDHGSLTITSV-NISDSGMYQCLAENKH 391

  Fly   741 KTSFSSAQLRVLSMKPSFKKHPLESEVYAVYNGNTTIVCDPEAAPRPKFQWKKDGQVIGSGGHRR 805
            .|.:|||:|||:::.|.|.|..::........|:..|.|.|:|:|:|...|||..::........
 Frog   392 GTIYSSAELRVIAVGPDFSKGFVKRVTLGKVGGSVLIECKPKASPKPSITWKKGKELQRESSRIS 456

  Fly   806 ILPSGTLTISPTSRDDEGIYTCIASNQAGTDESHARVIVLQEIRFIETPPQRIVSKEHDLIFLHC 870
            ||..|||.||..::.|.|.|||.|||..||..|...::|....:.: .||..:.....:.|.|.|
 Frog   457 ILDDGTLKISNLTKADAGSYTCTASNHFGTASSTGTLVVKDPTQVL-VPPSSMDVTVGESIVLPC 520

  Fly   871 EAAFDELLDIAYVWKHNGEVLKNNHDGTGRIIVDWNR---------LTVHNTSMRDAGDYECVVK 926
            :.:.|..|||::.|..||:::....||.     .:.|         |.:.:..::.||.|.|:|.
 Frog   521 QVSHDHSLDISFSWVFNGQLIDFQKDGE-----HFERVGGQDSAGDLMIRSIQLKHAGKYICLVH 580

  Fly   927 SAVNEISSKTSVSIEGAPGAPGGVQVIQISKTKAIIEWVDGSHNGRAIRYYNILGRTNWNRTWVN 991
            ::|:::|:...:.:.|.||.|..:.|.:|:.|.|.:.|:.|..|...|..|::..||.::..|..
 Frog   581 TSVDKLSAGADLIVRGPPGPPDALTVEEITDTTAQLSWMPGVDNHSPIIMYSVQARTPFSVGWQA 645

  Fly   992 VSTHVQAREVDRYTSRQQAEVVNLTPWSAYEFSVTAVNDLGIGTPSAPSPIYSTYEDKPYIAPRN 1056
            |||..:..:...:|    |.||.|:||..|||.|.|:|::|||.||.||....|.|..|.:.|.|
 Frog   646 VSTVPEVVDGRSFT----ATVVGLSPWVEYEFRVIAINEIGIGEPSPPSDKRRTEEALPEVTPAN 706

  Fly  1057 VGGGGGKIGDLTITWDPLLPQEQHSHGIHYKVFWKLKGAIEWASDEIKKQDHMGVAVVNIPLNNY 1121
            |.||||..|:|.|||:|:..:.|:..|..|.|.::..|.|.|....:...|.......|..|.. 
 Frog   707 VSGGGGSKGELVITWEPVPEELQNGGGFGYVVAFRPFGTISWMQTVVASADSSRYVYRNESLPP- 770

  Fly  1122 YTEYEVKVQAINSVGKGPESEIAVIHSAEDMPQVAPQKPIALAYNSTCFNVTWQPIDMSRENIRG 1186
            ::.|||||...|:.|:||.|.:.|::|||:.|..||....:.:..:....|:|..:..|..  :|
 Frog   771 FSPYEVKVGVYNNRGEGPFSPLTVVYSAEEEPGRAPAGVFSRSLTAWDIEVSWIAVPGSLS--KG 833

  Fly  1187 KLIGHRLKYWKTTHQEEDSVYYLSRTTRNWALIVGLQPDTYYFVKVMAYNAAGEGPESERFEERT 1251
            ::.|:.::|||...:|:::....:...:....:..||..|.|.:.|.|||:||.||.|......|
 Frog   834 RIQGYEVRYWKQNEKEQNARKLRTLGNQTSTKLSHLQGHTLYHLNVRAYNSAGTGPASTTVNVTT 898

  Fly  1252 YRKAPQKPPSSVHVYGINPSTVRVVWRYVSPSQDEEPVEGYKVRI-WE--SDQNMITANNTIVPI 1313
            .:..|.:||.:: ::..:.|.:.:.|..|:..:||..|:||:|.. |.  ...::|..|.|.|.:
 Frog   899 RKPPPSQPPGNI-IWNSSNSKIILNWDQVTAQEDESEVKGYRVLYRWNRPGGASVIETNQTSVEL 962

  Fly  1314 GQKLESYINNLTPGKSYNMRVLAYSNGGDGRMSSP------TLHFQMGKTTRNGANTRHGHNINT 1372
                     :|...:.|.:.:.:.|.||:|..|.|      :..:..|    :||:|   .|..|
 Frog   963 ---------SLPYDEDYIIEIRSISEGGEGSSSEPIRIPRISNAYAQG----SGAST---SNACT 1011

  Fly  1373 ALILSTLLLIST 1384
            ...:|||::..|
 Frog  1012 LSAISTLMISLT 1023

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ContNP_649461.2 CLECT 139..>223 CDD:214480
Ig 361..460 CDD:299845 28/99 (28%)
I-set 362..462 CDD:254352 28/100 (28%)
Ig 466..559 CDD:299845 32/94 (34%)
IG_like 584..657 CDD:214653 25/74 (34%)
IGc2 586..645 CDD:197706 21/59 (36%)
Ig 667..751 CDD:299845 29/83 (35%)
IG_like 676..751 CDD:214653 28/74 (38%)
IG_like 765..844 CDD:214653 28/78 (36%)
Ig 773..844 CDD:299845 28/70 (40%)
I-set 851..940 CDD:254352 23/97 (24%)
Ig 866..944 CDD:299845 22/86 (26%)
FN3 944..1043 CDD:238020 38/98 (39%)
FN3 1053..1146 CDD:238020 33/92 (36%)
fn3 1156..1244 CDD:278470 23/87 (26%)
fn3 1259..1346 CDD:278470 22/89 (25%)
cntn4NP_001135636.1 Ig 24..119 CDD:416386 30/105 (29%)
Ig strand A 26..30 CDD:409353 1/3 (33%)
Ig strand A' 33..38 CDD:409353 1/4 (25%)
Ig strand B 44..52 CDD:409353 2/10 (20%)
Ig strand C 57..63 CDD:409353 2/13 (15%)
Ig strand C' 65..68 CDD:409353 0/2 (0%)
Ig strand D 75..79 CDD:409353 2/3 (67%)
Ig strand E 81..87 CDD:409353 3/5 (60%)
Ig strand F 94..103 CDD:409353 3/8 (38%)
Ig strand G 106..119 CDD:409353 5/12 (42%)
Ig 128..213 CDD:416386 30/84 (36%)
Ig strand A 129..134 CDD:409353 1/4 (25%)
Ig strand B 138..144 CDD:409353 1/5 (20%)
Ig strand C 152..158 CDD:409353 2/5 (40%)
Ig strand C' 163..165 CDD:409353 0/1 (0%)
Ig strand D 170..175 CDD:409353 3/4 (75%)
Ig strand E 178..182 CDD:409353 2/3 (67%)
Ig strand F 192..200 CDD:409353 4/7 (57%)
Ig strand G 202..213 CDD:409353 3/10 (30%)
IgI_3_Contactin 226..314 CDD:409357 31/87 (36%)
Ig strand B 244..248 CDD:409357 1/3 (33%)
Ig strand C 257..261 CDD:409357 0/3 (0%)
Ig strand E 279..283 CDD:409357 2/3 (67%)
Ig strand F 293..298 CDD:409357 2/4 (50%)
Ig strand G 306..309 CDD:409357 1/2 (50%)
Ig 319..402 CDD:416386 29/87 (33%)
Ig strand A' 325..329 CDD:409353 1/3 (33%)
Ig strand B 333..341 CDD:409353 1/7 (14%)
Ig strand C 347..352 CDD:409353 3/4 (75%)
Ig strand C' 354..357 CDD:409353 0/2 (0%)
Ig strand D 362..366 CDD:409353 1/3 (33%)
Ig strand E 368..373 CDD:409353 2/4 (50%)
Ig strand F 382..389 CDD:409353 5/6 (83%)
Ig strand G 393..402 CDD:409353 5/8 (63%)
Ig5_Contactin 407..495 CDD:409358 31/87 (36%)
Ig strand B 426..430 CDD:409358 1/3 (33%)
Ig strand C 439..443 CDD:409358 0/3 (0%)
Ig strand E 461..465 CDD:409358 3/3 (100%)
Ig strand F 475..480 CDD:409358 3/4 (75%)
Ig strand G 488..491 CDD:409358 1/2 (50%)
Ig6_Contactin-4 497..598 CDD:409439 24/106 (23%)
Ig strand B 516..520 CDD:409439 2/3 (67%)
Ig strand C 531..535 CDD:409439 0/3 (0%)
Ig strand E 560..564 CDD:409439 1/3 (33%)
Ig strand F 574..579 CDD:409439 2/4 (50%)
Ig strand G 587..590 CDD:409439 1/2 (50%)
FN3 598..690 CDD:238020 36/95 (38%)
FN3 704..796 CDD:238020 34/92 (37%)
FN3 819..898 CDD:238020 22/80 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 73 1.000 Domainoid score I9051
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 475 1.000 Inparanoid score I1449
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D292460at33208
OrthoFinder 1 1.000 - - FOG0000550
OrthoInspector 1 1.000 - - otm48919
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X342
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
66.060

Return to query results.
Submit another query.