DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment hkb and YPR015C

DIOPT Version :9

Sequence 1:NP_524221.1 Gene:hkb / 40549 FlyBaseID:FBgn0261434 Length:297 Species:Drosophila melanogaster
Sequence 2:NP_015340.1 Gene:YPR015C / 856125 SGDID:S000006219 Length:247 Species:Saccharomyces cerevisiae


Alignment Length:209 Identity:55/209 - (26%)
Similarity:77/209 - (36%) Gaps:61/209 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    85 SSYTRTSTPLLDAAPH-----PVFSHPQSSPLDTHAAATASLAPPNQHAPFLSAASDLYYAAAAA 144
            ||..:|..|:..::|:     ||.:.||..||.  .....|..|              .|:.||:
Yeast    73 SSLHQTEDPVWRSSPNSIIFSPVIATPQPFPLT--FVERQSCCP--------------IYSTAAS 121

  Fly   145 AAAAASTPTAVPGF--------------------GMDPFTMGLMEQEYARVMAEDAQLKA-LNSR 188
            :..|.|.|.::..|                    |.:|.|  |:.|....:.....||:| :..|
Yeast   122 SYTAQSVPPSMQHFQEENHRAVSNEQYSLPNVHIGQNPGT--LLSQTQTDLDLIQKQLRAVVKLR 184

  Fly   189 KQRPKKFKCPNCDVAFSNNGQLKGHIRIHTGERPFKCDVNTCGKTFTRNEELTRHKRIHTGLRPY 253
            ||      ||.|....|....|:.|..||||:.||||....|.|:|.....:.||.|.|.     
Yeast   185 KQ------CPICGKVCSRPSTLRTHYLIHTGDTPFKCTWEHCNKSFNVKSNMLRHLRTHQ----- 238

  Fly   254 PCSACGKKFGRRDH 267
                  ||..::.|
Yeast   239 ------KKIAKKKH 246

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
hkbNP_524221.1 COG5048 195..>261 CDD:227381 21/65 (32%)
zf-C2H2 195..217 CDD:278523 6/21 (29%)
C2H2 Zn finger 197..217 CDD:275368 6/19 (32%)
zf-H2C2_2 210..236 CDD:290200 13/25 (52%)
C2H2 Zn finger 225..247 CDD:275368 7/21 (33%)
zf-H2C2_2 239..264 CDD:290200 6/24 (25%)
C2H2 Zn finger 255..275 CDD:275368 3/13 (23%)
YPR015CNP_015340.1 COG5048 <17..247 CDD:227381 55/209 (26%)
C2H2 Zn finger 187..207 CDD:275370 6/19 (32%)
C2H2 Zn finger 215..237 CDD:275370 7/21 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 54 1.000 Inparanoid score I1809
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.050

Return to query results.
Submit another query.