| Sequence 1: | NP_524221.1 | Gene: | hkb / 40549 | FlyBaseID: | FBgn0261434 | Length: | 297 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_114124.1 | Gene: | KLF16 / 83855 | HGNCID: | 16857 | Length: | 252 | Species: | Homo sapiens |
| Alignment Length: | 211 | Identity: | 70/211 - (33%) |
|---|---|---|---|
| Similarity: | 92/211 - (43%) | Gaps: | 28/211 - (13%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 99 PHPVFSHPQSSPLDTHAAATASLA---------PPNQHAPFLSAASDLYYAAAAAAAAAASTPTA 154
Fly 155 VPGFGMDPFTMGLMEQEYARVMAEDAQLKALNSRKQRPKKFKC--PNCDVAFSNNGQLKGHIRIH 217
Fly 218 TGERPFKCDVNTCGKTFTRNEELTRHKRIHTGLRPYPCSACGKKFGRRDHLKKHMKTH------- 275
Fly 276 --MPQERQLGPSIFVP 289 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| hkb | NP_524221.1 | COG5048 | 195..>261 | CDD:227381 | 31/67 (46%) |
| zf-C2H2 | 195..217 | CDD:278523 | 8/23 (35%) | ||
| C2H2 Zn finger | 197..217 | CDD:275368 | 8/21 (38%) | ||
| zf-H2C2_2 | 210..236 | CDD:290200 | 16/25 (64%) | ||
| C2H2 Zn finger | 225..247 | CDD:275368 | 11/21 (52%) | ||
| zf-H2C2_2 | 239..264 | CDD:290200 | 12/24 (50%) | ||
| C2H2 Zn finger | 255..275 | CDD:275368 | 10/19 (53%) | ||
| KLF16 | NP_114124.1 | KLF16_N | 2..>88 | CDD:409237 | 15/58 (26%) |
| Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 25..74 | 11/44 (25%) | |||
| Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 90..128 | 10/44 (23%) | |||
| COG5048 | 125..>189 | CDD:227381 | 30/63 (48%) | ||
| C2H2 Zn finger | 132..151 | CDD:275368 | 7/18 (39%) | ||
| C2H2 Zn finger | 159..181 | CDD:275368 | 11/21 (52%) | ||
| zf-C2H2 | 187..209 | CDD:395048 | 10/21 (48%) | ||
| C2H2 Zn finger | 189..209 | CDD:275368 | 10/19 (53%) | ||
| Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 204..252 | 8/29 (28%) |
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 1 | 1.050 | 101 | 1.000 | Inparanoid score | I4986 |
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| User_Submission | 0 | 0.000 | Not matched by this tool. | |||
| 2 | 1.960 | |||||