DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment hkb and sp5b

DIOPT Version :9

Sequence 1:NP_524221.1 Gene:hkb / 40549 FlyBaseID:FBgn0261434 Length:297 Species:Drosophila melanogaster
Sequence 2:XP_005172147.1 Gene:sp5b / 799504 ZFINID:ZDB-GENE-131231-1 Length:291 Species:Danio rerio


Alignment Length:285 Identity:80/285 - (28%)
Similarity:117/285 - (41%) Gaps:76/285 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    62 SASSSASSSSNSSKSCYEEALNH----SSYTRTSTPLLDAAPHPVFSHPQSSPLDTH-AAATASL 121
            ::||:..|..:|.....|:..|.    |....:..|.  |:|:.:| ||..|...|| :.:|.|:
Zfish    14 TSSSTPESIKSSPLMLLEDTCNRIGRASQSMESYIPY--ASPNKLF-HPWRSTDSTHLSQSTFSI 75

  Fly   122 APPNQHAPFLS--AASDLYYAAAAAAAAAASTPTAVPGFGMDPFTMGLMEQEYARVMAED----- 179
            .|.:|..|...  ..|.|......::..:...||..          ||:..:  |.:|.|     
Zfish    76 PPLHQDMPLTEHFDCSPLKMLPCPSSCISTCVPTHT----------GLVHAQ--RHLARDDIQWW 128

  Fly   180 ---------------------------AQLKALNSRKQRPKKFKCPNCD---------------- 201
                                       :|: .|||:.::.::..||||.                
Zfish   129 SSANHSSAHFQLTRGWILGQPEFGHYQSQI-LLNSKSRQSRRCMCPNCQKNADTPGRRKQHACHI 192

  Fly   202 ----VAFSNNGQLKGHIRIHTGERPFKCDVNTCGKTFTRNEELTRHKRIHTGLRPYPCSACGKKF 262
                ..:.....||.|:|.|.|||||.|....|||:|||::||.||.|.|||.:.:.|..|.|:|
Zfish   193 PGCAKVYGKTSHLKAHLRWHAGERPFICSWMFCGKSFTRSDELQRHLRTHTGEKRFTCPDCSKRF 257

  Fly   263 GRRDHLKKHMKTH-MPQERQLGPSI 286
            .|.|||.||:||| |.:.|.|.|.:
Zfish   258 MRSDHLAKHLKTHLMRKNRGLFPML 282

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
hkbNP_524221.1 COG5048 195..>261 CDD:227381 31/85 (36%)
zf-C2H2 195..217 CDD:278523 8/41 (20%)
C2H2 Zn finger 197..217 CDD:275368 8/39 (21%)
zf-H2C2_2 210..236 CDD:290200 15/25 (60%)
C2H2 Zn finger 225..247 CDD:275368 12/21 (57%)
zf-H2C2_2 239..264 CDD:290200 12/24 (50%)
C2H2 Zn finger 255..275 CDD:275368 11/19 (58%)
sp5bXP_005172147.1 C2H2 Zn finger 193..212 CDD:275368 4/18 (22%)
C2H2 Zn finger 220..242 CDD:275368 12/21 (57%)
zf-H2C2_2 234..257 CDD:290200 11/22 (50%)
zf-C2H2 248..270 CDD:278523 11/21 (52%)
C2H2 Zn finger 250..270 CDD:275368 11/19 (58%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.