| Sequence 1: | NP_524221.1 | Gene: | hkb / 40549 | FlyBaseID: | FBgn0261434 | Length: | 297 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_077744.4 | Gene: | WT1 / 7490 | HGNCID: | 12796 | Length: | 522 | Species: | Homo sapiens |
| Alignment Length: | 336 | Identity: | 83/336 - (24%) |
|---|---|---|---|
| Similarity: | 128/336 - (38%) | Gaps: | 96/336 - (28%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 34 VKQEPE--AITIKTELASSSFGHDCDGDFSSASSS-----------ASSSSNSSK---------S 76
Fly 77 CYEE--ALNHSSYTRTS---------TPLLDAAPHPVFSHPQSSPLDTHAA---ATASLAPP--N 125
Fly 126 QHAPFLSA------------ASDLYY---------------AAAAAAAAAASTPTAV-------- 155
Fly 156 --PGFGMDPFTMGLM---------------EQEYARV--MAEDAQLKALNSRKQRPKKFKC--PN 199
Fly 200 CDVAFSNNGQLKGHIRIHTGERPFKCDVNTCGKTFTRNEELTRHKRIHTGLRPYPCSACGKKFGR 264
Fly 265 RDHLKKHMKTH 275 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| hkb | NP_524221.1 | COG5048 | 195..>261 | CDD:227381 | 27/67 (40%) |
| zf-C2H2 | 195..217 | CDD:278523 | 7/23 (30%) | ||
| C2H2 Zn finger | 197..217 | CDD:275368 | 6/21 (29%) | ||
| zf-H2C2_2 | 210..236 | CDD:290200 | 12/25 (48%) | ||
| C2H2 Zn finger | 225..247 | CDD:275368 | 9/21 (43%) | ||
| zf-H2C2_2 | 239..264 | CDD:290200 | 12/24 (50%) | ||
| C2H2 Zn finger | 255..275 | CDD:275368 | 10/19 (53%) | ||
| WT1 | NP_077744.4 | WT1 | 74..394 | CDD:308009 | 44/248 (18%) |
| COG5048 | 386..>514 | CDD:227381 | 40/95 (42%) | ||
| C2H2 Zn finger | 401..420 | CDD:275368 | 5/18 (28%) | ||
| C2H2 Zn finger | 428..450 | CDD:275368 | 9/21 (43%) | ||
| C2H2 Zn finger | 458..478 | CDD:275368 | 10/19 (53%) | ||
| C2H2 Zn finger | 489..511 | CDD:275368 | |||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 1 | 1.050 | 101 | 1.000 | Inparanoid score | I4986 |
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| User_Submission | 0 | 0.000 | Not matched by this tool. | |||
| 2 | 1.960 | |||||