DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment hkb and klf4

DIOPT Version :9

Sequence 1:NP_524221.1 Gene:hkb / 40549 FlyBaseID:FBgn0261434 Length:297 Species:Drosophila melanogaster
Sequence 2:NP_001106955.1 Gene:klf4 / 562155 ZFINID:ZDB-GENE-111014-1 Length:396 Species:Danio rerio


Alignment Length:260 Identity:80/260 - (30%)
Similarity:112/260 - (43%) Gaps:60/260 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 IKTELASSSFGHDCDGDFSSASSSASSSSNSSKSCYEEALNHSSYTRTSTPLLDAAPHPVFSH-- 105
            :||.:..|        |::...|.:..:|....:|        ...:...|....|..|:..|  
Zfish   171 VKTTMDMS--------DYNQGVSISKDASAVPFAC--------PRIKQECPSTCTASRPMDLHLR 219

  Fly   106 --------PQSSPLDTHA-----AATASLAPPNQH--APFLSAASDLYYAAAAAAAAAASTPTAV 155
                    .|.|.||.||     .|.:||: |::|  ||.|.:.   |:           ..||.
Zfish   220 GSSAQSGVHQGSMLDPHAFSSGRGARSSLS-PDEHPQAPGLGSG---YH-----------PNTAY 269

  Fly   156 PGFGMDPFTMGLMEQEY---ARVMAEDAQLKALNSRKQRP-KKFKCPNCDVA-----FSNNGQLK 211
            .||...| ...|..||.   |..:.|:::.|  ..|:..| |:.....||.|     ::.:..||
Zfish   270 SGFPQAP-AQSLQYQELISPAEGLPEESKPK--RGRRSWPRKRIATHTCDYAGCGKTYTKSSHLK 331

  Fly   212 GHIRIHTGERPFKCDVNTCGKTFTRNEELTRHKRIHTGLRPYPCSACGKKFGRRDHLKKHMKTHM 276
            .|.|.||||:|:.||...||..|.|::|||||.|.|||:||:.|..|.:.|.|.|||..|||.|:
Zfish   332 AHHRTHTGEKPYHCDWEGCGWKFARSDELTRHYRKHTGIRPFQCLKCDRAFSRSDHLALHMKRHL 396

  Fly   277  276
            Zfish   397  396

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
hkbNP_524221.1 COG5048 195..>261 CDD:227381 31/70 (44%)
zf-C2H2 195..217 CDD:278523 7/26 (27%)
C2H2 Zn finger 197..217 CDD:275368 7/24 (29%)
zf-H2C2_2 210..236 CDD:290200 14/25 (56%)
C2H2 Zn finger 225..247 CDD:275368 12/21 (57%)
zf-H2C2_2 239..264 CDD:290200 14/24 (58%)
C2H2 Zn finger 255..275 CDD:275368 10/19 (53%)
klf4NP_001106955.1 zf-C2H2 313..337 CDD:278523 7/23 (30%)
C2H2 Zn finger 315..337 CDD:275368 7/21 (33%)
COG5048 <320..>375 CDD:227381 26/54 (48%)
C2H2 Zn finger 345..367 CDD:275368 12/21 (57%)
zf-H2C2_2 359..384 CDD:290200 14/24 (58%)
C2H2 Zn finger 375..395 CDD:275368 10/19 (53%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1591573at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.