DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment hkb and Spps

DIOPT Version :9

Sequence 1:NP_524221.1 Gene:hkb / 40549 FlyBaseID:FBgn0261434 Length:297 Species:Drosophila melanogaster
Sequence 2:NP_001262902.1 Gene:Spps / 42882 FlyBaseID:FBgn0039169 Length:985 Species:Drosophila melanogaster


Alignment Length:307 Identity:85/307 - (27%)
Similarity:117/307 - (38%) Gaps:65/307 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSTINLHPPQTYSRLFRPWDTQRQAATSAAPRTVKQEPEAITIKTELASSSFGHDCDGDFSSASS 65
            :::|...||.|:..:..   |....|.::.|.|...:.:.|         .|.|......||.|.
  Fly   549 ITSIKQEPPDTFGPISA---TGNPPAPASTPNTASPQQQQI---------KFLHTESNSLSSLSI 601

  Fly    66 SASSSSNSSKSCYEEALNHSSYTRTSTPLLDAAPHPVFSHPQSSPLDTHAAATASLAPPNQHAPF 130
            .||....        ||...:   |:||...|...|:   |.|.|..:...|..:.:.....||.
  Fly   602 PASIQIT--------ALPQQA---TNTPNTPATTQPI---PVSLPARSKVNAVTTSSTQITIAPT 652

  Fly   131 LSAASDLYYAAAAAAAAAASTPTAVPGFGMDPFTMGLMEQEYARVMAEDAQL----------KAL 185
            ......:...|..|.|:..||.|:..       |:....|.:..:....|.:          .|.
  Fly   653 GGQVVSVTTQARGATASIRSTNTSTT-------TITTPSQSHLNMNISVASVGGAATGGGGGTAT 710

  Fly   186 NSRKQRPKKF--KCPN--------------------CDVAFSNNGQLKGHIRIHTGERPFKCDVN 228
            ...|.|.|:.  .|||                    |...:.....|:.|:|.|||||||.|...
  Fly   711 GEPKPRLKRVACTCPNCTDGEKHSDKKRQHICHITGCHKVYGKTSHLRAHLRWHTGERPFVCSWA 775

  Fly   229 TCGKTFTRNEELTRHKRIHTGLRPYPCSACGKKFGRRDHLKKHMKTH 275
            .|||.|||::||.||:|.|||.:.:.|..|.|||.|.|||.||:|||
  Fly   776 FCGKRFTRSDELQRHRRTHTGEKRFQCQECNKKFMRSDHLSKHIKTH 822

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
hkbNP_524221.1 COG5048 195..>261 CDD:227381 31/87 (36%)
zf-C2H2 195..217 CDD:278523 7/43 (16%)
C2H2 Zn finger 197..217 CDD:275368 7/39 (18%)
zf-H2C2_2 210..236 CDD:290200 15/25 (60%)
C2H2 Zn finger 225..247 CDD:275368 12/21 (57%)
zf-H2C2_2 239..264 CDD:290200 13/24 (54%)
C2H2 Zn finger 255..275 CDD:275368 12/19 (63%)
SppsNP_001262902.1 COG5048 <725..827 CDD:227381 42/98 (43%)
C2H2 Zn finger 742..764 CDD:275368 4/21 (19%)
zf-H2C2_2 756..783 CDD:290200 15/26 (58%)
C2H2 Zn finger 772..794 CDD:275368 12/21 (57%)
zf-H2C2_2 786..809 CDD:290200 11/22 (50%)
zf-C2H2 800..822 CDD:278523 12/21 (57%)
C2H2 Zn finger 802..822 CDD:275368 12/19 (63%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23235
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.