DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment hkb and sp7

DIOPT Version :9

Sequence 1:NP_524221.1 Gene:hkb / 40549 FlyBaseID:FBgn0261434 Length:297 Species:Drosophila melanogaster
Sequence 2:NP_998028.1 Gene:sp7 / 405789 ZFINID:ZDB-GENE-040629-2 Length:440 Species:Danio rerio


Alignment Length:298 Identity:88/298 - (29%)
Similarity:127/298 - (42%) Gaps:39/298 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 PPQTYSRLFRPWDTQRQAATSAAPRTV--KQEPEAIT-IKTEL-ASSSFGHDCDGDFSSASSSAS 68
            |...|...:.|:.|.:.::.|..|..:  |...:.:| :.|.| .:..:|....|.....::|.:
Zfish    94 PTGAYGSEYNPFSTFQTSSVSQDPSLLGSKATADCLTSVNTYLDMTHPYGSWYKGIHPGITASPA 158

  Fly    69 SSSNSSKSCYEEALNHSSYTRTSTPLLDAAPHPVFSHPQSSPLDTHAAATASLAPPNQHAPF--- 130
            ::::|....:..| |..|..:.....|.|...||  .||:|......:.|....|.|. ||:   
Zfish   159 NATSSWWDVHTNA-NWLSPGQAQPDSLQAPLQPV--APQASLNPQMPSYTPDFTPLNP-APYPSV 219

  Fly   131 -LSAASDLYYAAAAAAAAAASTPTAVPGFGMDPFTMGLME----------------------QEY 172
             ||::|.|..::..........|..||..|:...:|||..                      ||.
Zfish   220 GLSSSSHLLQSSQHMLPQDMYKPKPVPTSGILDNSMGLKSARGSGYAAGSTTGRSSCDCPNCQEL 284

  Fly   173 ARVMAEDAQLKALNSRKQRPKKFKCPNCDVAFSNNGQLKGHIRIHTGERPFKCDVNTCGKTFTRN 237
            .|:.|..|.|     ||:.......|.|...:.....||.|:|.|||||||.|:...|||.|||:
Zfish   285 ERLGASAASL-----RKKPVHSCHIPGCGKVYGKASHLKAHLRWHTGERPFVCNWLFCGKRFTRS 344

  Fly   238 EELTRHKRIHTGLRPYPCSACGKKFGRRDHLKKHMKTH 275
            :||.||.|.||..:.:.|..|.|:|.|.|||.||.|||
Zfish   345 DELERHVRTHTREKKFTCLLCNKRFTRSDHLSKHQKTH 382

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
hkbNP_524221.1 COG5048 195..>261 CDD:227381 29/65 (45%)
zf-C2H2 195..217 CDD:278523 6/21 (29%)
C2H2 Zn finger 197..217 CDD:275368 6/19 (32%)
zf-H2C2_2 210..236 CDD:290200 16/25 (64%)
C2H2 Zn finger 225..247 CDD:275368 12/21 (57%)
zf-H2C2_2 239..264 CDD:290200 11/24 (46%)
C2H2 Zn finger 255..275 CDD:275368 11/19 (58%)
sp7NP_998028.1 zf-C2H2 300..324 CDD:278523 6/23 (26%)
zf-C2H2_8 302..386 CDD:292531 40/81 (49%)
C2H2 Zn finger 305..324 CDD:275368 6/18 (33%)
zf-H2C2_2 316..343 CDD:290200 16/26 (62%)
C2H2 Zn finger 332..354 CDD:275368 12/21 (57%)
zf-H2C2_2 346..371 CDD:290200 11/24 (46%)
C2H2 Zn finger 362..382 CDD:275368 11/19 (58%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.