DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment hkb and Kr

DIOPT Version :9

Sequence 1:NP_524221.1 Gene:hkb / 40549 FlyBaseID:FBgn0261434 Length:297 Species:Drosophila melanogaster
Sequence 2:NP_001261181.1 Gene:Kr / 38012 FlyBaseID:FBgn0001325 Length:502 Species:Drosophila melanogaster


Alignment Length:278 Identity:78/278 - (28%)
Similarity:120/278 - (43%) Gaps:43/278 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 TQRQAATSAAPRTVKQEPEAITIKTELASSSFGHDCDGDFSSASSSASSSSNSSKSCYEEALNHS 85
            ||..||...|...:.|.|     .:.||::.|.|:....|.:.::..|.....:......|..||
  Fly    71 TQLLAANRQAAAFMAQLP-----MSTLANTLFPHNPAALFGAWAAQQSLPPQGTHLHSPPASPHS 130

  Fly    86 SYTRTSTPLLDAAPHPVFSHPQSSPLDTHAAATA-SLAPPNQHAPFLS-AASDLYYAAAA--AAA 146
            .   .||| |.:..||:.| |.|:|.....|..| .|:...:....:| :.:|:|:.:..  :..
  Fly   131 P---LSTP-LGSGKHPLNS-PNSTPQHHEPAKKARKLSVKKEFQTEISMSVNDMYHTSGGPISPP 190

  Fly   147 AAASTPTAV----------PGFGMDP-----FTMGLMEQEYARVMAEDAQLKALNSRKQR----P 192
            ::.|:|.:.          .|...||     ||..:..:.:.        .|.:....:|    .
  Fly   191 SSGSSPNSTHDGAGGNAGCVGVSKDPSRDKSFTCKICSRSFG--------YKHVLQNHERTHTGE 247

  Fly   193 KKFKCPNCDVAFSNNGQLKGHIRIHTGERPFKCDVNTCGKTFTRNEELTRHKRIHTGLRPYPCSA 257
            |.|:||.|...|:.:..||.|:|:||||:|:.|  :.|.:.|.:...|.||.|:|||.|||.|..
  Fly   248 KPFECPECHKRFTRDHHLKTHMRLHTGEKPYHC--SHCDRQFVQVANLRRHLRVHTGERPYTCEI 310

  Fly   258 CGKKFGRRDHLKKHMKTH 275
            |..||...:.||.||..|
  Fly   311 CDGKFSDSNQLKSHMLVH 328

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
hkbNP_524221.1 COG5048 195..>261 CDD:227381 29/65 (45%)
zf-C2H2 195..217 CDD:278523 9/21 (43%)
C2H2 Zn finger 197..217 CDD:275368 8/19 (42%)
zf-H2C2_2 210..236 CDD:290200 12/25 (48%)
C2H2 Zn finger 225..247 CDD:275368 7/21 (33%)
zf-H2C2_2 239..264 CDD:290200 14/24 (58%)
C2H2 Zn finger 255..275 CDD:275368 8/19 (42%)
KrNP_001261181.1 C2H2 Zn finger 224..244 CDD:275368 2/27 (7%)
zf-H2C2_2 237..261 CDD:290200 7/23 (30%)
C2H2 Zn finger 252..272 CDD:275368 8/19 (42%)
zf-H2C2_2 264..289 CDD:290200 12/26 (46%)
C2H2 Zn finger 280..300 CDD:275368 7/21 (33%)
zf-H2C2_2 292..316 CDD:290200 13/23 (57%)
C2H2 Zn finger 308..328 CDD:275368 8/19 (42%)
zf-H2C2_2 321..345 CDD:290200 5/8 (63%)
C2H2 Zn finger 336..352 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 54 1.000 Inparanoid score I1809
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.960

Return to query results.
Submit another query.