DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment hkb and CG3065

DIOPT Version :9

Sequence 1:NP_524221.1 Gene:hkb / 40549 FlyBaseID:FBgn0261434 Length:297 Species:Drosophila melanogaster
Sequence 2:NP_611861.1 Gene:CG3065 / 37818 FlyBaseID:FBgn0034946 Length:400 Species:Drosophila melanogaster


Alignment Length:210 Identity:70/210 - (33%)
Similarity:93/210 - (44%) Gaps:24/210 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    90 TSTPLLDAAPHPVFSHPQSSPLDTHAAATASLAPPNQHAPFLSAASDLYYAAAAAAAAAASTPTA 154
            ||||:....|.|.|  |..|..:.|          .|.:..:..||.::.......|...:    
  Fly    16 TSTPIEPMKPPPAF--PTMSGANIH----------EQASDMILRASTIFEDVKHDEANVEN---- 64

  Fly   155 VPGFGM-----DPFTMGLMEQEYARVMAEDAQLKALNSRKQRPKKFKCP--NCDVAFSNNGQLKG 212
            ||..|:     |....|.......|:| ...:|.|........:||.||  ||..::..:..|:.
  Fly    65 VPHHGVETEPEDDSHYGGNGNSKIRIM-PSVKLMATTLASDPKRKFVCPYDNCTKSYGKSSHLRS 128

  Fly   213 HIRIHTGERPFKCDVNTCGKTFTRNEELTRHKRIHTGLRPYPCSACGKKFGRRDHLKKHMKTHMP 277
            |:..|||.:||.|....|||.|||::||.||.|.|||.:|:.|..|.|||.|.|||.||:.||..
  Fly   129 HLTWHTGIKPFVCSEPKCGKGFTRSDELNRHLRTHTGEKPFECIQCTKKFSRSDHLTKHLATHDR 193

  Fly   278 QERQLGPSIFVPMYS 292
            |.:...|...||..|
  Fly   194 QLKGSTPKRTVPSSS 208

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
hkbNP_524221.1 COG5048 195..>261 CDD:227381 30/67 (45%)
zf-C2H2 195..217 CDD:278523 7/23 (30%)
C2H2 Zn finger 197..217 CDD:275368 6/21 (29%)
zf-H2C2_2 210..236 CDD:290200 12/25 (48%)
C2H2 Zn finger 225..247 CDD:275368 12/21 (57%)
zf-H2C2_2 239..264 CDD:290200 14/24 (58%)
C2H2 Zn finger 255..275 CDD:275368 11/19 (58%)
CG3065NP_611861.1 COG5048 99..>400 CDD:227381 47/110 (43%)
C2H2 Zn finger 111..133 CDD:275368 6/21 (29%)
zf-C2H2 139..163 CDD:278523 13/23 (57%)
C2H2 Zn finger 141..163 CDD:275368 12/21 (57%)
zf-H2C2_2 155..180 CDD:290200 14/24 (58%)
C2H2 Zn finger 171..191 CDD:275368 11/19 (58%)
zf-C2H2 346..368 CDD:278523
C2H2 Zn finger 348..368 CDD:275368
zf-H2C2_2 360..385 CDD:290200
C2H2 Zn finger 376..396 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23235
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.