DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment hkb and CG42741

DIOPT Version :9

Sequence 1:NP_524221.1 Gene:hkb / 40549 FlyBaseID:FBgn0261434 Length:297 Species:Drosophila melanogaster
Sequence 2:NP_611747.2 Gene:CG42741 / 37654 FlyBaseID:FBgn0261705 Length:362 Species:Drosophila melanogaster


Alignment Length:264 Identity:69/264 - (26%)
Similarity:109/264 - (41%) Gaps:63/264 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 AITIKTELASSSFGHDCDGDFSSASSSASSSSNSSKSCYEEALNHSSYTRTSTPLLDAAPHPVFS 104
            ::::|.|..::|    |..:..|:|..|.|::||.:. ||     |.::..|          :|.
  Fly   134 SVSVKQEDNNNS----CSYNNGSSSGGAGSAANSMQD-YE-----SKFSLLS----------LFK 178

  Fly   105 HP------------QSSPLDTHAAATASLAPPNQHAPFLSAASDLYYAAAAAAAAAASTPTAVPG 157
            :|            ::||....:...||.:.|:..:          ||.:.:..||.:     |.
  Fly   179 NPYKFAGGDGQASRKTSPTGGSSKPLASNSSPSWKS----------YAGSGSPHAALN-----PA 228

  Fly   158 FG-------------MDPFTMGLMEQEYARVMAEDAQLK-ALNSRKQRPKKFKC--PNCDVAFSN 206
            ||             ......|.....:....:.|:... ..|...:..|..||  ..||..::.
  Fly   229 FGGMGRGATRKDNSSFSGINFGGGGSAFGFTTSSDSMANGGYNDLSKNRKVHKCDTEGCDKVYTK 293

  Fly   207 NGQLKGHIRIHTGERPFKCDVNTCGKTFTRNEELTRHKRIHTGLRPYPCSACGKKFGRRDHLKKH 271
            :..||.|.|.||||:|:.|....|...|.|::|||||.|.|||::|:.|..|.:.|.|.|||..|
  Fly   294 SSHLKAHKRTHTGEKPYVCTWEGCIWRFARSDELTRHYRKHTGVKPFRCQLCTRSFSRSDHLSLH 358

  Fly   272 MKTH 275
            |:.|
  Fly   359 MRRH 362

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
hkbNP_524221.1 COG5048 195..>261 CDD:227381 29/67 (43%)
zf-C2H2 195..217 CDD:278523 8/23 (35%)
C2H2 Zn finger 197..217 CDD:275368 7/21 (33%)
zf-H2C2_2 210..236 CDD:290200 12/25 (48%)
C2H2 Zn finger 225..247 CDD:275368 10/21 (48%)
zf-H2C2_2 239..264 CDD:290200 13/24 (54%)
C2H2 Zn finger 255..275 CDD:275368 9/19 (47%)
CG42741NP_611747.2 COG5048 <273..>352 CDD:227381 31/78 (40%)
zf-C2H2 280..304 CDD:278523 8/23 (35%)
C2H2 Zn finger 282..304 CDD:275368 7/21 (33%)
zf-H2C2_2 296..>313 CDD:290200 9/16 (56%)
C2H2 Zn finger 312..334 CDD:275368 10/21 (48%)
zf-H2C2_2 326..351 CDD:290200 13/24 (54%)
C2H2 Zn finger 342..362 CDD:275368 9/19 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23235
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.