DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment hkb and sug

DIOPT Version :9

Sequence 1:NP_524221.1 Gene:hkb / 40549 FlyBaseID:FBgn0261434 Length:297 Species:Drosophila melanogaster
Sequence 2:NP_610826.1 Gene:sug / 36424 FlyBaseID:FBgn0033782 Length:384 Species:Drosophila melanogaster


Alignment Length:260 Identity:64/260 - (24%)
Similarity:97/260 - (37%) Gaps:74/260 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 PRTV-----KQEPEAITIKT-----ELASSSFGHDCDGDFSSASSSASSSSNSSKSCYEEALNHS 85
            ||.:     :|..:::.:|.     ||..|..      :|...|.|.||||... :..:...|.:
  Fly    76 PRPIAGYGYRQRTQSVIMKARGQQDELCRSPV------EFPDDSKSCSSSSECG-TASDFVCNWT 133

  Fly    86 SYTRTSTPLLDAAPHPVFSHPQSSPLDTHAAATASLAPPNQHAPFLSAASDLYYAAAAAAAAAAS 150
            ...|....|...|.|....|           |.|||            ...|||........:..
  Fly   134 DCDRVFDTLDALAQHVTQRH-----------AIASL------------TDGLYYCRWRGCQRSER 175

  Fly   151 TPTAVPGFGMDPFTMGLMEQEYARVMAEDAQLKAL----NSRKQRPKKFKCPNCDVAFSNNGQLK 211
                  ||                    :|:.|.|    ...|::|  .:|..|:.:||....||
  Fly   176 ------GF--------------------NARYKMLVHTRTHTKEKP--HRCHLCEKSFSRAENLK 212

  Fly   212 GHIRIHTGERPFKCDVNTCGKTFTRNEELTRHKRIHTGLRPYPC--SACGKKFGRRDHLKKHMKT 274
            .|||.|:||:|:||....|.|.::.:.:..:|.|.|:..:||.|  :.|.|::.....|:||:||
  Fly   213 IHIRSHSGEKPYKCSFEGCQKAYSNSSDRFKHTRTHSMEKPYMCKVAGCQKRYTDPSSLRKHVKT 277

  Fly   275  274
              Fly   278  277

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
hkbNP_524221.1 COG5048 195..>261 CDD:227381 24/67 (36%)
zf-C2H2 195..217 CDD:278523 9/21 (43%)
C2H2 Zn finger 197..217 CDD:275368 9/19 (47%)
zf-H2C2_2 210..236 CDD:290200 13/25 (52%)
C2H2 Zn finger 225..247 CDD:275368 5/21 (24%)
zf-H2C2_2 239..264 CDD:290200 8/26 (31%)
C2H2 Zn finger 255..275 CDD:275368 8/22 (36%)
sugNP_610826.1 C2H2 Zn finger 170..190 CDD:275368 5/45 (11%)
zf-H2C2_2 183..207 CDD:290200 6/25 (24%)
COG5048 192..>271 CDD:227381 27/80 (34%)
C2H2 Zn finger 198..218 CDD:275368 9/19 (47%)
zf-H2C2_2 210..237 CDD:290200 13/26 (50%)
C2H2 Zn finger 226..248 CDD:275368 5/21 (24%)
C2H2 Zn finger 256..277 CDD:275368 6/20 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 54 1.000 Inparanoid score I1809
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.050

Return to query results.
Submit another query.