DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment hkb and Cf2

DIOPT Version :9

Sequence 1:NP_524221.1 Gene:hkb / 40549 FlyBaseID:FBgn0261434 Length:297 Species:Drosophila melanogaster
Sequence 2:NP_001350854.1 Gene:Cf2 / 33692 FlyBaseID:FBgn0000286 Length:537 Species:Drosophila melanogaster


Alignment Length:89 Identity:39/89 - (43%)
Similarity:54/89 - (60%) Gaps:9/89 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   194 KFKCPNCDVAFSNNGQLKGHIRIHTG-------ERPFKCDVNTCGKTFTRNEELTRHKRIHTGLR 251
            :.|||:|...|...|.|..|.:||||       |||:.|  :.|||:||::..|.:|.|||||.:
  Fly   365 RHKCPDCPKTFKTPGTLAMHRKIHTGEADATPKERPYTC--SYCGKSFTQSNTLKQHTRIHTGEK 427

  Fly   252 PYPCSACGKKFGRRDHLKKHMKTH 275
            |:.|..|.|.|..:|:|.||::||
  Fly   428 PFHCGYCEKSFSVKDYLTKHIRTH 451

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
hkbNP_524221.1 COG5048 195..>261 CDD:227381 31/72 (43%)
zf-C2H2 195..217 CDD:278523 8/21 (38%)
C2H2 Zn finger 197..217 CDD:275368 7/19 (37%)
zf-H2C2_2 210..236 CDD:290200 14/32 (44%)
C2H2 Zn finger 225..247 CDD:275368 9/21 (43%)
zf-H2C2_2 239..264 CDD:290200 12/24 (50%)
C2H2 Zn finger 255..275 CDD:275368 8/19 (42%)
Cf2NP_001350854.1 COG5048 <366..>473 CDD:227381 39/88 (44%)
C2H2 Zn finger 368..388 CDD:275368 7/19 (37%)
C2H2 Zn finger 403..423 CDD:275368 9/21 (43%)
C2H2 Zn finger 431..451 CDD:275368 8/19 (42%)
zf-H2C2_2 443..468 CDD:316026 5/9 (56%)
C2H2 Zn finger 459..480 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 54 1.000 Inparanoid score I1809
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.960

Return to query results.
Submit another query.