DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment hkb and cbt

DIOPT Version :9

Sequence 1:NP_524221.1 Gene:hkb / 40549 FlyBaseID:FBgn0261434 Length:297 Species:Drosophila melanogaster
Sequence 2:NP_722636.1 Gene:cbt / 33224 FlyBaseID:FBgn0043364 Length:428 Species:Drosophila melanogaster


Alignment Length:311 Identity:95/311 - (30%)
Similarity:128/311 - (41%) Gaps:76/311 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 PWDTQRQAATSAAP-RTVKQEPEAITI------------KTELASSSFGHDCDGDFSSASSSASS 69
            |.||:.:|...|.| :..:.|..|:::            |.|..|.....:..|..|  |||...
  Fly    58 PSDTEDEAPEIAVPNKKPRLEQPAMSMTPPPDQKLDDDQKAERVSVIMRVNSSGAVS--SSSQDE 120

  Fly    70 SSNSSKSCYEEALNHSSYTRTSTPLLDAAPHPVFSHPQSS--------------------PLDTH 114
            :|:||.||    .:.||.|.|||.  ...|.....:|:::                    |:.|.
  Fly   121 NSSSSTSC----CSSSSNTNTSTS--SVPPTVEDDYPEANVWRNLKFKMNRKRAAEVALPPVQTP 179

  Fly   115 AAATASLAPPNQHA------------------PFLSAASDLYYAAAAAAAAAASTPTAVPGFGMD 161
            ....|.|..|...|                  |..|:||.|   ...:..||..:||.||     
  Fly   180 ETPVAKLVTPPAPAECIKEEEIKPILTPIYVSPVASSASQL---ILLSTVAAQQSPTPVP----- 236

  Fly   162 PFTMGLMEQEYARVMAEDAQLKALNSRKQRPKKFKC--PNCDVAFSNNGQLKGHIRIHTGERPFK 224
              ....|.:|........||..|..||     .::|  |:|...:..:..||.|.|:|||||||.
  Fly   237 --KTPTMSEEKLTTRITAAQAAATRSR-----IYECSFPDCGKNYFKSSHLKAHQRVHTGERPFI 294

  Fly   225 CDVNTCGKTFTRNEELTRHKRIHTGLRPYPCSACGKKFGRRDHLKKHMKTH 275
            |....|.|.|:|::||:||||.|||.:.:.||.|.|||.|.|||.||:|.|
  Fly   295 CKWENCDKRFSRSDELSRHKRTHTGEKKFQCSVCQKKFMRSDHLSKHVKRH 345

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
hkbNP_524221.1 COG5048 195..>261 CDD:227381 31/67 (46%)
zf-C2H2 195..217 CDD:278523 7/23 (30%)
C2H2 Zn finger 197..217 CDD:275368 7/21 (33%)
zf-H2C2_2 210..236 CDD:290200 15/25 (60%)
C2H2 Zn finger 225..247 CDD:275368 11/21 (52%)
zf-H2C2_2 239..264 CDD:290200 15/24 (63%)
C2H2 Zn finger 255..275 CDD:275368 13/19 (68%)
cbtNP_722636.1 zf-C2H2 263..287 CDD:278523 7/23 (30%)
C2H2 Zn finger 265..287 CDD:275368 7/21 (33%)
COG5048 <270..362 CDD:227381 40/76 (53%)
zf-H2C2_2 279..306 CDD:290200 15/26 (58%)
C2H2 Zn finger 295..317 CDD:275368 11/21 (52%)
zf-H2C2_2 309..332 CDD:290200 13/22 (59%)
zf-C2H2 323..345 CDD:278523 13/21 (62%)
C2H2 Zn finger 325..345 CDD:275368 13/19 (68%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23235
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.